DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and Iqca1

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001355651.1 Gene:Iqca1 / 74918 MGIID:1922168 Length:838 Species:Mus musculus


Alignment Length:101 Identity:20/101 - (19%)
Similarity:49/101 - (48%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNITLPNTEERVNLLKSRINRL-GDITVAGDV-CAREIAMKTKNFTEDELCQLVREALHEAIVR 63
            ::.:..|:...|..|.|..|.|. |.:|.:.:: |..::   |..||:.::.|::::.|.|..:|
Mouse   708 IILVPRPDYASRYVLWKEIILRNGGKLTNSLNISCLSKV---TDGFTQGQIVQVIKDVLTERRLR 769

  Fly    64 THVTRCPKGLQVTQVDLLAAVKIIQPRFGRQEETLQ 99
            ....:     .:|.::.:..:..:.|.:..:||:.:
Mouse   770 QQAHK-----PLTAIEFITMMTNMNPVYREEEESFK 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232 17/88 (19%)
AAA 129..257 CDD:459627
Iqca1NP_001355651.1 P-loop containing Nucleoside Triphosphate Hydrolases 552..711 CDD:476819 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.