DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and CG16789

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster


Alignment Length:246 Identity:53/246 - (21%)
Similarity:86/246 - (34%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KTKNFTEDELCQLVREALHEAIVRTHVTRCPKGLQVTQVDLLAAVKIIQPRFGRQE---ETLQLL 101
            |.|:.|.|.    ..|:|:|.:|...:.|....|::.|   ....|.:..|.|...   :..|:|
  Fly   490 KEKDLTPDR----TTESLYEELVTNGIIRKYPELRLKQ---FLGDKALTARIGTNPSPGDIRQIL 547

  Fly   102 MPYEYLDRTAFDP--NDLLSTGRPRWSCHLVEGKPKSG--------LTTVAAQMALKTDCPFI-K 155
            ..|..|      |  :|.:....|.....|:.|...||        .|.|.|.:...|....: |
  Fly   548 TEYCIL------PLGSDAIHNCTPLIRSILLAGPKGSGKKALLHAICTEVGAVLFDLTPANIVGK 606

  Fly   156 YISSAELLGLSDSEKCQRIREVLEDAYVSRRSCVIIDDFERVIGYGALGKRYSKEFLQKLTVL-- 218
            |...:.|:.|        |..||:.:.:.:.:.:.:.|.||             .|::|:...  
  Fly   607 YPGKSGLIML--------IHLVLKVSRLLQPAVIFMGDAER-------------PFMKKIPKTDR 650

  Fly   219 -----LKKQPPN-------SHELIIICTSNRLDVLEELGLLSVFTSVHNVP 257
                 |||..|.       ...::.|.|||.....::..|.||:.....:|
  Fly   651 TDPKRLKKDLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIP 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232 12/47 (26%)
AAA 129..257 CDD:459627 31/150 (21%)
CG16789NP_649910.3 DUF5401 <131..>307 CDD:375164
SpoVK 443..773 CDD:440232 53/246 (22%)
P-loop containing Nucleoside Triphosphate Hydrolases 542..700 CDD:476819 38/184 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.