DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and TER94

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster


Alignment Length:154 Identity:40/154 - (25%)
Similarity:63/154 - (40%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RISTTEILSTYRFVYHSILDPLF-FNIVPFMWMCIFSLLTLYEIYKSRHNTYQHLAFDHPK-QTN 259
            :||||..:.  .|||.:|::|:. .|..|.:::...|.:.|..|.|........:.:.|.: ..|
  Fly   117 QISTTPPIG--HFVYLTIVEPVTEINGGPDLFINKGSTINLTCIVKYAPEPPPAVVWKHNRDDIN 179

  Fly   260 VTHPLAGCFPKKAELIRQKQELRATFSIVAIIL-----LYLCFHSLKLFAVVRKWQLLVKRECPT 319
            ...|..|     ..|:.:|..|..:..:|...:     ||.|..|....|.||..  ::..|.|.
  Fly   180 FDSPRGG-----ISLVTEKGILTTSRLLVQKAIASDSGLYTCEPSNANPASVRVH--ILNGEHPA 237

  Fly   320 RKDYYHSHLSDVLSMISASVNAFV 343
            .   .|..:|.:||  ..|:.|||
  Fly   238 A---MHHGISTILS--GPSLVAFV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232
AAA 129..257 CDD:459627 16/61 (26%)
TER94NP_001097249.1 CDC48 47..787 CDD:273521 40/154 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.