DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and Iqca1l

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_808344.3 Gene:Iqca1l / 231045 MGIID:3045319 Length:825 Species:Mus musculus


Alignment Length:149 Identity:33/149 - (22%)
Similarity:58/149 - (38%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 KRYSKEFLQKLTVLLKKQPPNSHELIIICTSNRLDVLEELGLLSVFTSVHNVPNVSTPKELMVIV 269
            ||..|:.::     ..||......:::|.|:.|..:.|..||...:..:..:|........::  
Mouse   653 KRIKKDLMR-----ATKQLSPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVL-- 710

  Fly   270 EASKRFEPEELRQIEIAMDGRNVSI-------GIKRLLD------LIAWVNSLNPDRRAAKLLKK 321
              .||.         |...||.|.:       .:.|:.|      ::..:.|:..:||..:|:||
Mouse   711 --WKRM---------IESQGRGVQLTSSLDVSALARVSDGYTPSHILQSIQSVLTERRLLQLIKK 764

  Fly   322 LGEAMGWVGNHSSPLVPQY 340
            ...|..:|| |.:.|.|.|
Mouse   765 PLVASEFVG-HLARLDPVY 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232
AAA 129..257 CDD:459627 11/51 (22%)
Iqca1lNP_808344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..487
P-loop containing Nucleoside Triphosphate Hydrolases 540..699 CDD:476819 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.