DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31778 and CTF18

DIOPT Version :10

Sequence 1:NP_722932.1 Gene:CG31778 / 261616 FlyBaseID:FBgn0051778 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_171966.2 Gene:CTF18 / 839431 AraportID:AT1G04730 Length:943 Species:Arabidopsis thaliana


Alignment Length:85 Identity:15/85 - (17%)
Similarity:28/85 - (32%) Gaps:32/85 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILAVILEQPFTAEAVVRDACQTAPNKSVWLCSPSTLGIFFDPETQRCRYMGCSNRKLFLTLEDCE 80
            :||:.::|....|...:...|.:..||         ||...||.::..                 
plant   801 VLALAMKQVLVHEVEKQKILQASGGKS---------GILNKPEIKKIN----------------- 839

  Fly    81 KICNNPRHIKRRNQAKANET 100
                  :.:.::..|.|||:
plant   840 ------QDLAKKTNAAANES 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31778NP_722932.1 Kunitz-type 46..83 CDD:444694 4/36 (11%)
CTF18NP_171966.2 PRK04195 337..>650 CDD:235250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.