powered by:
Protein Alignment CG31778 and chtf18
DIOPT Version :9
Sequence 1: | NP_001285596.1 |
Gene: | CG31778 / 261616 |
FlyBaseID: | FBgn0051778 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001103572.2 |
Gene: | chtf18 / 554366 |
ZFINID: | ZDB-GENE-050522-508 |
Length: | 957 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 14/65 - (21%) |
Similarity: | 20/65 - (30%) |
Gaps: | 16/65 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 LAVILEQPFTAEAVVRDACQTAPNKSVWLCSPSTLGIFFDPETQRCRYMGCSNRKLFLTLEDCEK 81
|..:.|.|....|..|.|.:..|....::....::| ||......||.||
Zfish 153 LGALQESPKQVTAAKRHAQKRPPAIGDYITVTDSMG----------------NRVYLNKKEDVEK 201
Fly 82 81
Zfish 202 201
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31778 | NP_001285596.1 |
KU |
46..83 |
CDD:294074 |
7/36 (19%) |
chtf18 | NP_001103572.2 |
AAA |
362..505 |
CDD:99707 |
|
AAA |
365..497 |
CDD:214640 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1969 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.