powered by:
Protein Alignment CG31778 and cutlet
DIOPT Version :9
Sequence 1: | NP_001285596.1 |
Gene: | CG31778 / 261616 |
FlyBaseID: | FBgn0051778 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_787969.1 |
Gene: | cutlet / 44637 |
FlyBaseID: | FBgn0015376 |
Length: | 993 |
Species: | Drosophila melanogaster |
Alignment Length: | 33 |
Identity: | 10/33 - (30%) |
Similarity: | 15/33 - (45%) |
Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 SNRKLFLTLEDCEKIC-NNPRHIKRRNQAKANE 99
:||.|...|:..:|:. ....|.||..:|...|
Fly 340 TNRSLLYWLKMWDKVVFGKAFHSKREQEAVTGE 372
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31778 | NP_001285596.1 |
KU |
46..83 |
CDD:294074 |
5/14 (36%) |
cutlet | NP_787969.1 |
AAA |
424..555 |
CDD:99707 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1969 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.