DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31908 and SZRD1

DIOPT Version :9

Sequence 1:NP_001285699.1 Gene:CG31908 / 261613 FlyBaseID:FBgn0051908 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001108072.1 Gene:SZRD1 / 26099 HGNCID:30232 Length:152 Species:Homo sapiens


Alignment Length:210 Identity:56/210 - (26%)
Similarity:79/210 - (37%) Gaps:79/210 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDVLDNWEEIDEDG-LSMTLQTKLQTSDPPVNKMKLLQR-PQSVQESSQILSSGDGGGGGGNGGG 67
            |:|.::|||..:.| :...|:.||:.:.....|.|...: |..:|:.|  |.:|           
Human     4 EEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDS--LPAG----------- 55

  Fly    68 NPPPRQITIARKPQVPPAEVDSSTQQEQQQQPVMMVLHKTTNDYDAATYCTPTSNQTVKILRRPA 132
              ||.||.|.::|                          |:|    ....:|.|..         
Human    56 --PPPQIRILKRP--------------------------TSN----GVVSSPNSTS--------- 79

  Fly   133 QAEERRDINGMRPKQPIKTLKQREQEYAEARLRILGAAKNPEDDKPATPITPAVNSSSVAVSSAA 197
                       ||..|:|:|.|||.||||||.||||:| :||::: ..||.......|....|..
Human    80 -----------RPTLPVKSLAQREAEYAEARKRILGSA-SPEEEQ-EKPILDRPTRISQPEDSRQ 131

  Fly   198 PPVTPPSAISNNNVI 212
            |          ||||
Human   132 P----------NNVI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31908NP_001285699.1 SUZ 123..170 CDD:289518 18/46 (39%)
SZRD1NP_001108072.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..152 47/184 (26%)
SUZ 56..107 CDD:403836 29/101 (29%)
SUZ-C 119..151 CDD:403952 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12342
eggNOG 1 0.900 - - E1_2APPH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107226
Panther 1 1.100 - - LDO PTHR31796
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.