DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31908 and Szrd1

DIOPT Version :9

Sequence 1:NP_001285699.1 Gene:CG31908 / 261613 FlyBaseID:FBgn0051908 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006538757.1 Gene:Szrd1 / 213491 MGIID:1098672 Length:160 Species:Mus musculus


Alignment Length:182 Identity:44/182 - (24%)
Similarity:68/182 - (37%) Gaps:84/182 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NWEE-IDEDGLSMTLQTKLQTSDPPVNKMKLLQRPQSVQESSQILSSGDGGGGGGNGGGNPPPRQ 73
            :|:: :::||....:..:|:      .|:|:.|:.....:|                   ||...
Mouse    13 HWQDSVEKDGAREEIDRRLE------KKLKITQKESRKSKS-------------------PPKVP 52

  Fly    74 ITIA--RKPQVPPAEVDSSTQQEQQQQPVMMVLHKTTNDYDAATYCTPTSNQTVKILRRPAQAEE 136
            |.|.  ..|..||.:                                      ::||:||..   
Mouse    53 IVIQDDSLPTGPPPQ--------------------------------------IRILKRPTS--- 76

  Fly   137 RRDINGM--------RPKQPIKTLKQREQEYAEARLRILGAAKNPED--DKP 178
                ||:        ||..|:|:|.|||.||||||.||||:| :||:  :||
Mouse    77 ----NGVVSSPNSTSRPALPVKSLAQREAEYAEARRRILGSA-SPEEEQEKP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31908NP_001285699.1 SUZ 123..170 CDD:289518 24/54 (44%)
Szrd1XP_006538757.1 SUZ 64..115 CDD:372290 27/96 (28%)
SUZ-C 143..159 CDD:372374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12280
eggNOG 1 0.900 - - E1_2APPH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107226
Panther 1 1.100 - - LDO PTHR31796
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.