DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant4 and GALNTL5

DIOPT Version :9

Sequence 1:NP_001137779.1 Gene:Pgant4 / 261610 FlyBaseID:FBgn0051956 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_016867282.1 Gene:GALNTL5 / 168391 HGNCID:21725 Length:496 Species:Homo sapiens


Alignment Length:395 Identity:159/395 - (40%)
Similarity:217/395 - (54%) Gaps:56/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EADRKRSGFG---EHGVAVKIENPD-EKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTR 171
            :.|:.:|..|   .|      .||: .|:|.|     .|||.:||..:.:.|.|||.|.:.|..:
Human   127 DEDKAKSMLGTDFNH------TNPELHKELLK-----YGFNVIISRSLGIEREVPDTRSKMCLQK 180

  Fly   172 KYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQH 236
            .|.|:||..|::..|:||..|.|.:::.||.|.||...|::|:||||.|:.|.||:.| ||..:.
Human   181 HYPARLPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKL-DYHLET 244

  Fly   237 FPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMV 301
            |...|.|:||.:|:|||.||:.||..|.|.|:||.|||.|||..||.||:..||.:||:..||::
Human   245 FRGKVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLI 309

  Fly   302 DTISHEDFSYFSGNKDG--ARGGFDWKMLYKQLPVL------PEDALDKSMPYRSPVMMGGLFAI 358
            |.|......|    |..  .||.|||.:.:|...|.      ||.:   :.|.|||.|.||:|||
Human   310 DVIDDRTLEY----KPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGS---TKPIRSPAMSGGIFAI 367

  Fly   359 NTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNP------R 417
            ...:|.::|.||..:|.||.|..|||.:||||||.|..:|||||.||.:   |..|.|      .
Human   368 RRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISK---KQTGKPSTIISAM 429

  Fly   418 GHNFVAKNHKRVAEVWMDEYKQYVYKRDP----KTYDNLDAGDLTRQR-GVRERLKCKSFHWFMT 477
            .||::     |:..||:||||:..:.|.|    .||.|:      |:| .:|:||.||||.|::.
Human   430 THNYL-----RLVHVWLDEYKEQFFLRKPGLKYVTYGNI------RERVELRKRLGCKSFQWYLD 483

  Fly   478 EVAPD 482
            .|.|:
Human   484 NVFPE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant4NP_001137779.1 BcsA 169..>403 CDD:224136 107/241 (44%)
pp-GalNAc-T 181..480 CDD:133004 133/317 (42%)
Ricin_B_lectin 496..626 CDD:279046
RICIN 498..628 CDD:238092
GALNTL5XP_016867282.1 GT2 187..437 CDD:224137 113/265 (43%)
pp-GalNAc-T 190..486 CDD:133004 133/317 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.