DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant4 and LOC100486078

DIOPT Version :9

Sequence 1:NP_001137779.1 Gene:Pgant4 / 261610 FlyBaseID:FBgn0051956 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_002945237.1 Gene:LOC100486078 / 100486078 -ID:- Length:139 Species:Xenopus tropicalis


Alignment Length:95 Identity:27/95 - (28%)
Similarity:42/95 - (44%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 DVHEGPPNAT-------------VWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLEGFVENGI 609
            |:..|.|..|             |.::.||...|||.|.| |:.:.:.|..:|. |::  ...|.
 Frog    43 DIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKY-RRDKTVYHPTSNS-CMD--CNEGE 103

  Fly   610 AKVVANSCENGNDRQRWEFGFVNHTMLDTF 639
            .|:..|.|...:..|:|.|..:|.|:|:.|
 Frog   104 YKIFMNKCNPSSPTQQWTFEHINSTILEAF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant4NP_001137779.1 BcsA 169..>403 CDD:224136
pp-GalNAc-T 181..480 CDD:133004
Ricin_B_lectin 496..626 CDD:279046 21/80 (26%)
RICIN 498..628 CDD:238092 22/82 (27%)
LOC100486078XP_002945237.1 RICIN 2..122 CDD:238092 22/82 (27%)
Ricin_B_lectin 2..120 CDD:279046 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D144590at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.