DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq4 and AT2G03690

DIOPT Version :9

Sequence 1:NP_001246815.1 Gene:Coq4 / 261607 FlyBaseID:FBgn0052174 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_178465.1 Gene:AT2G03690 / 814897 AraportID:AT2G03690 Length:226 Species:Arabidopsis thaliana


Alignment Length:216 Identity:92/216 - (42%)
Similarity:142/216 - (65%) Gaps:2/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KERIEISPFQRLFLGAGSSIAALLNPRRHDMIACLGETTGEDALWTILDTMQASEEGQRIMADKP 111
            :.|:.:|.:|:..:..||::.||::|||.|:||.||||||:.|...:|:.|:.||||:.|:.::|
plant     5 RARVPLSRWQQAAVAMGSALGALVDPRRADLIAALGETTGKPAFEMVLERMKKSEEGRAILLERP 69

  Fly   112 RIHTSTIDFKYLETLPPDTFGAAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRECHDLIHT 176
            |:.:..:...:  .||.:||||||.||:.....:||.|..|||:|..:|||:.||.||.|||.||
plant    70 RVVSEQVGHAW--DLPENTFGAAYAKFMGSRNFSPDDRPPVRFMETDELAYVATRAREVHDLWHT 132

  Fly   177 VLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALENGKRTKPLM 241
            :..:|||::||.::|.:|.....||||....:.|.||...|||..:||||||||:..|::...||
plant   133 LFGLPTNLIGESSLKVIEFEQMYLPMCMLSVIGGTVRFNEKQRSMFLKHYLPWAVRAGRQCTDLM 197

  Fly   242 PVYWEKRWEQNIHELRSELGI 262
            .||:|:.:.:::.::|.:.||
plant   198 CVYYERHFSEDLEQVRRKWGI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq4NP_001246815.1 Coq4 54..265 CDD:282826 90/209 (43%)
AT2G03690NP_178465.1 Coq4 12..222 CDD:398612 90/209 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 189 1.000 Domainoid score I954
eggNOG 1 0.900 - - E1_COG5031
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68641
Inparanoid 1 1.050 189 1.000 Inparanoid score I1392
OMA 1 1.010 - - QHG54901
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004197
OrthoInspector 1 1.000 - - oto3984
orthoMCL 1 0.900 - - OOG6_103250
Panther 1 1.100 - - LDO PTHR12922
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2942
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.