DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32445 and GAL10

DIOPT Version :9

Sequence 1:NP_730671.1 Gene:CG32445 / 261603 FlyBaseID:FBgn0052445 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_009575.1 Gene:GAL10 / 852307 SGDID:S000000223 Length:699 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:104/341 - (30%)
Similarity:165/341 - (48%) Gaps:54/341 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MGAIIQSLKVPDFNGKLEDVCLGYDDVAGYYRNQQYFFGATIGRVANRTAHGRFKLCGK--EVSV 103
            :||.|..|||   ||  :.|.|||::..||......:.||||||.|||.:.|:|.||.|  :::|
Yeast   391 LGASIVDLKV---NG--QSVVLGYENEEGYLNPDSAYIGATIGRYANRISKGKFSLCNKDYQLTV 450

  Fly   104 SRNLRDRHHQNGGF--VGFDSVIWDVVGVHKDGVTLQHISPDGHEG--YPGELTTNINFSLNETG 164
            :..:...|...|.|  ..|...|  :....||..|.:::..|..:.  :||:|...|.:::| ..
Yeast   451 NNGVNANHSSIGSFHRKRFLGPI--IQNPSKDVFTAEYMLIDNEKDTEFPGDLLVTIQYTVN-VA 512

  Fly   165 CFGMRIEARTKAT----TAVNISNHSFFNL-AGHGAGRDTLYQHMLMIKAQKIVDVDQELLPTGK 224
            ...:.:..:.|.|    |.:|::|||:||| ..:|   ||:....:|::::|.||||:.::|||.
Yeast   513 QKSLEMVYKGKLTAGEATPINLTNHSYFNLNKPYG---DTIEGTEIMVRSKKSVDVDKNMIPTGN 574

  Fly   225 LMRVRTTPYDFSSLVSLGKRLNQVSTCPLGGFDNHFCVD--IPP-------NRVQLVARVVHPCS 280
            ::......::.:....||.:..|...|        |.||  ..|       |.:.|:.:..||.|
Yeast   575 IVDREIATFNSTKPTVLGPKNPQFDCC--------FVVDENAKPSQINTLNNELTLIVKAFHPDS 631

  Fly   281 GRFMEVHTNQPGLQFSTANHLPSEDGSDIPIAGKDGVNYVRQGAFTLETQKYPDAMNHCDFPS-V 344
            ...:||.:.:|..||.|.:.|.         ||.:    .||| |.:|..:|.||:|..::.. |
Yeast   632 NITLEVLSTEPTYQFYTGDFLS---------AGYE----ARQG-FAIEPGRYIDAINQENWKDCV 682

  Fly   345 VLNPGQLYDHQVVYRF 360
            .|..|:.|..::||||
Yeast   683 TLKNGETYGSKIVYRF 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32445NP_730671.1 galactose_mutarotase_like 25..360 CDD:185696 102/339 (30%)
GAL10NP_009575.1 UDP_G4E_1_SDR_e 14..349 CDD:187558
galactose_mutarotase_like 376..698 CDD:185696 102/339 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I1291
eggNOG 1 0.900 - - E1_COG2017
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.