DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32445 and MFNG

DIOPT Version :9

Sequence 1:NP_730671.1 Gene:CG32445 / 261603 FlyBaseID:FBgn0052445 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_002396.2 Gene:MFNG / 4242 HGNCID:7038 Length:321 Species:Homo sapiens


Alignment Length:180 Identity:38/180 - (21%)
Similarity:56/180 - (31%) Gaps:67/180 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VDVDQELLPTGKLMRVRTTPYDFSSLV---SLGKRLNQVSTCP------------LGGFDNHFCV 262
            ||.|..:.|...|..:|..|......|   ||.:.::.....|            .||..  ||:
Human   141 VDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAG--FCI 203

  Fly   263 DIPPNRVQLVARVVHPCSG-RFMEV------------------------------HTNQPGLQFS 296
                || :|..::....|| |||:.                              |::...||..
Human   204 ----NR-KLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLL 263

  Fly   297 TANHLPSEDGSDIPI-AGKDGVNYVR-QGAFTLETQK----------YPD 334
            ....||.:......: .||  :|.:: ||.|:.|...          |||
Human   264 RTAQLPEQVTLSYGVFEGK--LNVIKLQGPFSPEEDPSRFRSLHCLLYPD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32445NP_730671.1 galactose_mutarotase_like 25..360 CDD:185696 38/180 (21%)
MFNGNP_002396.2 Fringe 51..300 CDD:190308 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.