DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32445 and LFNG

DIOPT Version :9

Sequence 1:NP_730671.1 Gene:CG32445 / 261603 FlyBaseID:FBgn0052445 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001035257.1 Gene:LFNG / 3955 HGNCID:6560 Length:379 Species:Homo sapiens


Alignment Length:53 Identity:13/53 - (24%)
Similarity:21/53 - (39%) Gaps:17/53 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KRLNQVSTCPL--------GGFDNH---------FCVDIPPNRVQLVARVVHP 278
            :.|.||.|..|        |.|:|.         |.|:..|:|.:.:...::|
Human   316 ENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32445NP_730671.1 galactose_mutarotase_like 25..360 CDD:185696 13/53 (25%)
LFNGNP_001035257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..107
Fringe 110..358 CDD:190308 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.