powered by:
Protein Alignment CG32445 and lfng
DIOPT Version :9
Sequence 1: | NP_730671.1 |
Gene: | CG32445 / 261603 |
FlyBaseID: | FBgn0052445 |
Length: | 367 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571046.1 |
Gene: | lfng / 30158 |
ZFINID: | ZDB-GENE-980605-16 |
Length: | 374 |
Species: | Danio rerio |
Alignment Length: | 53 |
Identity: | 14/53 - (26%) |
Similarity: | 22/53 - (41%) |
Gaps: | 17/53 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 KRLNQVS--------TCPLGGFDNH---------FCVDIPPNRVQLVARVVHP 278
:.|.||| |...|.|:|. |.|:..|:|.:.|..:::|
Zfish 311 ENLQQVSKSEVHKQITLSYGMFENKRNIINMKGAFSVEEDPSRFKSVHCLLYP 363
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.960 |
|
Return to query results.
Submit another query.