powered by:
Protein Alignment CG32445 and Rfng
DIOPT Version :9
Sequence 1: | NP_730671.1 |
Gene: | CG32445 / 261603 |
FlyBaseID: | FBgn0052445 |
Length: | 367 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033079.1 |
Gene: | Rfng / 19719 |
MGIID: | 894275 |
Length: | 332 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 29/66 - (43%) |
Gaps: | 15/66 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 227 RVRTTPYDFSSLVSL-----GKRLNQVSTCPLGGFDN-HFCVDI--------PPNRVQLVARVVH 277
|:..:|...|.|.:| |..|.|| |...||.:| |..|:: .|.|.|.|..:::
Mouse 252 RLLHSPLFHSHLENLQRLPSGAILQQV-TLSYGGPENPHNVVNVAGSFNIQQDPTRFQSVHCLLY 315
Fly 278 P 278
|
Mouse 316 P 316
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.