DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRE5

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_510966.1 Gene:ADGRE5 / 976 HGNCID:1711 Length:835 Species:Homo sapiens


Alignment Length:218 Identity:43/218 - (19%)
Similarity:79/218 - (36%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 AGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWE 342
            ||.:.|.| ::::.|.|:....|:              ||:...|                   :
Human   616 AGLLHYCF-LAAFCWMSLEGLELY--------------FLVVRVF-------------------Q 646

  Fly   343 NDPGKSEWLPLVGY------FGCSVKDWN-------------SSSWFYSHI-PIVILNSFNVIMF 387
            .....:.||.|:||      .|.|...::             ...:.:|.: |:..:...|.::|
Human   647 GQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIF 711

  Fly   388 VLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLL 452
            |.|   :||:   .:.|::.:.......:....|.....:||| :|.:|:....  :.:|..|:|
Human   712 VTT---VWKL---TQKFSEINPDMKKLKKARALTITAIAQLFL-LGCTWVFGLF--IFDDRSLVL 767

  Fly   453 DTIVLNLTVYLNAAFGILIFVLL 475
             |.|..:...|..||..|:..||
Human   768 -TYVFTILNCLQGAFLYLLHCLL 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
ADGRE5NP_510966.1 EGF_CA 64..99 CDD:284955
EGF_CA 116..>148 CDD:214542
EGF_CA 160..207 CDD:284955
EGF_CA 209..243 CDD:284955
GPS 493..536 CDD:280071
7tm_2 544..782 CDD:278432 39/209 (19%)
ProP 608..>785 CDD:223553 40/212 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 814..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.