DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRG1

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005256294.1 Gene:ADGRG1 / 9289 HGNCID:4512 Length:698 Species:Homo sapiens


Alignment Length:526 Identity:98/526 - (18%)
Similarity:179/526 - (34%) Gaps:181/526 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DETINISHFK-----RLNDAYIYEHFEIPANLTGEFDYKELMDGSKV--PTEFPNLRGCICKVRP 87
            ::.||.:.:|     .|.|.:|:..        .|.:..|:|:.|.:  .|.|...:|       
Human   235 EDRINATVWKLQPTAGLQDLHIHSR--------QEEEQSEIMEYSVLLPRTLFQRTKG------- 284

  Fly    88 CIRICCARKNILSNGECSDGVKNEIKLTMLDLTMQDILL---TDPTLAE--LNMIPQ----YNST 143
                        .:||.      |.:|.::|.:.|.:..   :...|.|  |.::.|    .|.|
Human   285 ------------RSGEA------EKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLT 331

  Fly   144 ELLILREQFQPCDEIVSLK----RDEYTILKDGSILLHTSAEILSNDQYCLYPEIYSDFPETI-R 203
            |.::|..|.|...:.|:|:    .::.|:...|    |.|:      ..|          ||: |
Human   332 EPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPG----HWSS------AGC----------ETVRR 376

  Fly   204 IINRRCYRNVMPGIA---------------QLSVISVVGFI-------LTLAVYLSV-------E 239
            .....|:.|.:...|               .||::|.||.:       :|:|.||..       .
Human   377 ETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRR 441

  Fly   240 KLRNLLGKCLICSLFSMFMEYFIWTMDYFRLL---------QSICSAAGYMKYFFSMSSYLWFSV 295
            |.|:...|..:..|.::|:      :|...||         ::.|.|:....:|..::...|..:
Human   442 KPRDYTIKVHMNLLLAVFL------LDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGL 500

  Fly   296 VSFHLWELFTSL-NRHEPQYR------------FLI----------YNTFVWCTAAIPTVVIFSM 337
            ..::|:.|...: ..:.|.|.            ||:          |...:......|..||:. 
Human   501 EGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYP- 564

  Fly   338 NQMWENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKGVK 402
            :..|..|       .||.|.        ::...:|   :|.|  ||:.|.....:.|.:::...:
Human   565 SMCWIRD-------SLVSYI--------TNLGLFS---LVFL--FNMAMLATMVVQILRLRPHTQ 609

  Fly   403 SFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNAAF 467
            .::.               .:..:.|.|::|..|.|...:..:....|    :||.|...:.:..
Human   610 KWSH---------------VLTLLGLSLVLGLPWALIFFSFASGTFQL----VVLYLFSIITSFQ 655

  Fly   468 GILIFV 473
            |.|||:
Human   656 GFLIFI 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 39/199 (20%)
ADGRG1XP_005256294.1 GPS 349..393 CDD:280071 12/63 (19%)
7tm_4 408..659 CDD:304433 53/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.