DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRE3

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_115960.2 Gene:ADGRE3 / 84658 HGNCID:23647 Length:652 Species:Homo sapiens


Alignment Length:290 Identity:61/290 - (21%)
Similarity:114/290 - (39%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSVISVVG-------FILTLAVYLSVEKLRNL-------LGKCLICSLFSMFMEYFIWTMDYFRL 270
            |:||:.||       .:|....:|..:.:||.       |..||       |:.:.::.:...|.
Human   356 LTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCL-------FLAHLLFLVGIDRT 413

  Fly   271 LQSI-CS-AAGYMKYFFSMSSYLWFSVVSFHLWEL--------FTSLNRHEPQYRFLI-YNTFVW 324
            ...: || .||.:.|.: ::::.|..:...||:..        ::|:||......|.: |     
Human   414 EPKVLCSIIAGALHYLY-LAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGY----- 472

  Fly   325 CTAAIPTVVIFSMNQMWENDPGKSE--WLPLVGYFGCSVKDWNSSSWFYSHI-PIVILNSFNVIM 386
               .:|.|.:......|.:..|.::  ||.|            ...:.:|.: |:..:.|.|:::
Human   473 ---GVPAVTVAISAASWPHLYGTADRCWLHL------------DQGFMWSFLGPVCAIFSANLVL 522

  Fly   387 FVLTAIYIWKVKKGVKSFAQHDE--RNTTCLEFNVQTYIQFVRLFLIMGASWLLD--QLTRLAED 447
            |:|.   .|.:|:.:.|......  :||..|.|...     .:|| |:|.:|.|.  |:...|: 
Human   523 FILV---FWILKRKLSSLNSEVSTIQNTRMLAFKAT-----AQLF-ILGCTWCLGLLQVGPAAQ- 577

  Fly   448 SHLLLDTIVLNLTVYLNAAFGILIFVLLIL 477
                   ::..|...:|:..|..||::..|
Human   578 -------VMAYLFTIINSLQGFFIFLVYCL 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
ADGRE3NP_115960.2 EGF_CA 67..104 CDD:238011
GPS 304..344 CDD:280071
7tm_4 353..594 CDD:304433 58/282 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.