DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgrf1

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_006525183.1 Gene:Adgrf1 / 77596 MGIID:1924846 Length:927 Species:Mus musculus


Alignment Length:562 Identity:106/562 - (18%)
Similarity:196/562 - (34%) Gaps:192/562 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IIVTIAKNSSAKIPHCKYDETINISHFKRLNDAYIYEHFEIPANLTGEF-DYK------------ 63
            |::..||::|:::  .|..|:|          :.:.....:|.|.:|:| |:|            
Mouse   410 ILLQDAKDASSQL--LKTLESI----------SSLIPSMALPLNFSGKFIDWKGTPVTQIQSTRG 462

  Fly    64 -----ELMDGSKVPTEFPNLRGCIC-------KVRPCIRICCARKNILSNGECSDGVKNEIKLTM 116
                 |:...:.:|     :||.:.       |..|        |.|:|               |
Mouse   463 YNYQMEMRQNASLP-----IRGHVFIEPDQFQKSHP--------KTIIS---------------M 499

  Fly   117 LDLTMQDIL---------LTDPTLAELNMIPQYNSTELLILREQFQPCDEIVSLKRDEYTILKDG 172
            ..||..|||         :..|.::.|  |..|:.:|:.:   .|......::..|   .:..|.
Mouse   500 ASLTFGDILPITQRGNAWVNGPVISTL--IQNYSISEIFL---NFSKIKGNLTQPR---CVFWDF 556

  Fly   173 SILLHTSAEI-LSNDQYCLYPEIYSDFPETIRIINRRC-----YRNVMPGIAQLSVISVVGFILT 231
            |.|..::|.. |.|              ||:..:..||     :..:|......||:.||.:|..
Mouse   557 SQLQWSNAGCQLVN--------------ETLDTVLCRCSHLTSFSMLMSPFVPSSVVPVVKWITY 607

  Fly   232 LAVYLSVEKL----------------------RNLLGKCLICSLFSMFMEYFIW-----TMDYFR 269
            :.:.:|:..|                      ||:   ||:....|:.:. .:|     |:|...
Mouse   608 IGLSISIASLILCLIIESLFWKQTKRSQTSYTRNI---CLVNIAVSLLIA-DVWFIIAATVDPSV 668

  Fly   270 LLQSICSAAGYMKYFFSMSSYLWFSVVS----------FHLWELFTSLNRHEPQYRFLI-YNTFV 323
            ....:|.||.:..:||.::.:.|..|:.          ||...|.|.:     ...|.: |.   
Mouse   669 SPSGVCVAAVFFTHFFYLAVFFWMLVLGILLAYRIILVFHHMALTTMM-----AIGFCLGYG--- 725

  Fly   324 WCTAAIPTVVI--------FSMNQM-WENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVIL 379
             |...|..:.:        :..|.: |.|...||:  ||:.:.                :|.:.:
Mouse   726 -CPLLISIITLAVTQPSNSYKRNDVCWLNWSDKSK--PLLAFV----------------VPALTI 771

  Fly   380 NSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRL 444
            .:.|:::.:|....:|:...|.:  ...|::.|.     ::.....:.|..::|.:|.....|  
Mouse   772 VAVNLVVVLLVLRKLWRPAVGER--LNQDDKATA-----IRMGKSLLVLTPLLGLTWGFGIGT-- 827

  Fly   445 AEDSHLLLDTIVLNLTVYLNAAFGILIFVLLILKGSTFKMIM 486
            ..:||.|...::..|   |||..|..||...||..:..:.::
Mouse   828 MANSHNLAWHVLFAL---LNAFQGFFIFCFGILLDTKLRQLL 866

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 39/216 (18%)
Adgrf1XP_006525183.1 SEA 172..258 CDD:366610
GPS 549..590 CDD:197639 11/57 (19%)
7tm_GPCRs 603..866 CDD:391938 56/305 (18%)
TM helix 1 603..626 CDD:341315 3/22 (14%)
TM helix 2 641..663 CDD:341315 5/25 (20%)
TM helix 3 675..702 CDD:341315 6/26 (23%)
TM helix 4 716..736 CDD:341315 4/28 (14%)
TM helix 5 757..786 CDD:341315 7/46 (15%)
TM helix 6 803..829 CDD:341315 4/32 (13%)
TM helix 7 834..859 CDD:341315 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.