DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgrl3.1

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005170997.1 Gene:adgrl3.1 / 560631 ZFINID:ZDB-GENE-030131-7856 Length:1540 Species:Danio rerio


Alignment Length:290 Identity:65/290 - (22%)
Similarity:116/290 - (40%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSVISVVGFILTLAVYL----------SVEKLRNLLGKCLICSLF---SMFMEYFIWTMDYFRLL 271
            |.||:.||.:|:|...|          .::..||.:.|.|..|||   ::|:      ....|..
Zfish   870 LDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFIAETLFL------TGINRAD 928

  Fly   272 QSI-CSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIF 335
            |.| |:....:.:||.::::.|..:....|:.:...:  .|.:|....|  |......:|.|::.
Zfish   929 QPIVCAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEV--FESEYSRTKY--FYLTGYGVPAVIVA 989

  Fly   336 SMNQMWENDPGKSE--WLPLVGYFGCSVKDWNSSSWFYSHI-PIVILNSFNVIMFVLTAIYIWKV 397
            ....:.....|...  ||.|..||            .:|.| |..::...||| |:..|:|    
Zfish   990 VSAAVDYRSYGTERVCWLRLDTYF------------IWSFIGPATLIIMLNVI-FLGIALY---- 1037

  Fly   398 KKGVKSFAQHD---ERNTTCLEFNVQTY-IQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLN 458
                |.| .|.   :.::.||: |:::: |..:.|..::|.:|... |..:.|.:     .|:..
Zfish  1038 ----KMF-HHTAILKPDSGCLD-NIKSWVIGAIALLCLLGLTWAFG-LMYINEST-----VIMAY 1090

  Fly   459 LTVYLNAAFGILIFVLLILKGSTFKMIMER 488
            |....|:..|:.||:        |..|:::
Zfish  1091 LFTIFNSLQGMFIFI--------FHCILQK 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
adgrl3.1XP_005170997.1 Gal_Lectin 66..146 CDD:280328
OLF 160..415 CDD:128580
HormR 493..553 CDD:214468
GAIN 562..780 CDD:293098
GPS 807..859 CDD:197639
7tm_2 868..1103 CDD:278432 61/271 (23%)
Latrophilin 1124..1540 CDD:280509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.