DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Dh44-R2

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:400 Identity:77/400 - (19%)
Similarity:140/400 - (35%) Gaps:165/400 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PQYNSTELLILREQFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSNDQYCLYP----EIYSDF 198
            |:.|:..|.:|     ||.|  ..|...|....:.:             ::| :|    :.|||:
  Fly    95 PRTNAGSLAVL-----PCFE--EFKGVHYDTTDNAT-------------RFC-FPNGTWDHYSDY 138

  Fly   199 PETIRIINRRCYRN---------VMPGIAQLSVISVVGFILTLA-------VYLSVEKLRNLLGK 247
            .        ||::|         ..|.:...::|...|:.|:.|       ::||.:.||     
  Fly   139 D--------RCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLR----- 190

  Fly   248 CLICSLF-SMFMEY----FIWTMDYF-RLLQSICSAAG-----YMKYFFSMSSYLWFSVVSFHLW 301
            ||..::. ::|:.|    .:|.:..| :::.:..|.||     .|..:|.::::.|..|...:|:
  Fly   191 CLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLY 255

  Fly   302 EL----FTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVK 362
            .|    |:|.|     ..|:||....|                                 ||   
  Fly   256 TLVVQTFSSDN-----ISFIIYALIGW---------------------------------GC--- 279

  Fly   363 DWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQH-DERNTTCLEFNV----QTY 422
                        |.|             .|.:|.:   .|:||.| :..:...||.:.    :::
  Fly   280 ------------PAV-------------CILVWSI---AKAFAPHLENEHFNGLEIDCAWMRESH 316

  Fly   423 IQF-----------VRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFVLLI 476
            |.:           |.|..::...|:|  :|:| ..:|      .|....|..|:..:|  ||:.
  Fly   317 IDWIFKVPASLALLVNLVFLIRIMWVL--ITKL-RSAH------TLETRQYYKASKALL--VLIP 370

  Fly   477 LKGSTFKMIM 486
            |.|.|:.:::
  Fly   371 LFGITYLLVL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 14/74 (19%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 16/77 (21%)
7tm_2 159..407 CDD:278432 59/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.