DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgre5

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001012164.1 Gene:Adgre5 / 361383 RGDID:1305595 Length:825 Species:Rattus norvegicus


Alignment Length:317 Identity:56/317 - (17%)
Similarity:104/317 - (32%) Gaps:100/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 CYRNVMPGIA-----------QLSVISVVGFILTLAVYL----------SVEKLRNLLGKCLICS 252
            |:.|.:...|           :|.:|:.||.:|:|...|          .::..|.::...|...
  Rat   515 CHCNHLTSFAVLMAQYHVQDPRLELITKVGLLLSLVCLLLCILTFLLVKPIQSSRTMVHLHLCIC 579

  Fly   253 LFSMFMEYFIWTMDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFL 317
            ||...:.:.:...:....:...|.....:.:|..::::.|.::....|:              ||
  Rat   580 LFLGSVIFLVGVENEGGEVGLRCRLVAMLLHFCFLAAFCWMALEGVELY--------------FL 630

  Fly   318 IYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEW-LPLVGY-----------------FGCSVKDW 364
            :...|                    ...|.|.| ..||||                 :|.:...|
  Rat   631 VVRVF--------------------QGQGLSTWHRCLVGYGVPLLIVAISAAARMDGYGHATYCW 675

  Fly   365 -----NSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQ 424
                 ....|.:|. |:..:...|..:||:|   :||:   .|.|::.:.......:..|.|...
  Rat   676 LDFRKQGFLWSFSG-PVAFIIFCNAAIFVIT---VWKL---TKKFSEINPNMKKLRKARVLTITA 733

  Fly   425 FVRLFLIMGASWLLDQLTRLAEDSHLLL----DTIVLNLTVYLNAAFGILIFVLLIL 477
            ..:| |::|.:|          ...|.|    .|.:..:...||...|:.::|.|.|
  Rat   734 IAQL-LVLGCTW----------GFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVTLCL 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 56/317 (18%)
Adgre5NP_001012164.1 EGF_CA 69..>101 CDD:214542
EGF_CA 171..218 CDD:284955
EGF_CA 220..265 CDD:284955
GPS 487..526 CDD:280071 3/10 (30%)
7tm_2 534..773 CDD:278432 50/290 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.