DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRD2

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001382354.1 Gene:ADGRD2 / 347088 HGNCID:18651 Length:982 Species:Homo sapiens


Alignment Length:293 Identity:60/293 - (20%)
Similarity:107/293 - (36%) Gaps:60/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSVISVVG-----------FILTLAVYLSVEKLRNLLGKCLICSLFSMFMEYFIWTMDYFRLLQS 273
            |..:|.||           |:|.|...:...: |..:.|.|..||.|  .|.|:.|.::.:..:.
Human   695 LRTLSFVGCGVSFCALTTTFLLFLVAGVPKSE-RTTVHKNLTFSLAS--AEGFLMTSEWAKANEV 756

  Fly   274 ICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMN 338
            .|.|.....:|..:.::.|..|....||....:::.| |.....:|:...|   .:|..::....
Human   757 ACVAVTVAMHFLFLVAFSWMLVEGLLLWRKVVAVSMH-PGPGMRLYHATGW---GVPVGIVAVTL 817

  Fly   339 QMWEND---PGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTA--IYIWKVK 398
            .|..:|   ||.           |.:....::.|.:          ...::|||||  ..:.:|.
Human   818 AMLPHDYVAPGH-----------CWLNVHTNAIWAF----------VGPVLFVLTANTCILARVV 861

  Fly   399 KGVKSFAQHDERNTT---CLEFNVQTYI-----QFVRLFLIMGASWLLDQLTRLAEDSHLLLDTI 455
            ....|.|:...|..:   ||:..:.|.|     ..:.|..::|.:||...|..|:        ..
Human   862 MITVSSARRRARMLSPQPCLQQQIWTQIWATVKPVLVLLPVLGLTWLAGILVHLS--------PA 918

  Fly   456 VLNLTVYLNAAFGILIFVLLILKGSTFKMIMER 488
            .....|.||:..|:.||::........:..::|
Human   919 WAYAAVGLNSIQGLYIFLVYAACNEEVRSALQR 951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
ADGRD2NP_001382354.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.