DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgrg1

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001018317.1 Gene:adgrg1 / 324948 ZFINID:ZDB-GENE-030131-3671 Length:648 Species:Danio rerio


Alignment Length:331 Identity:57/331 - (17%)
Similarity:115/331 - (34%) Gaps:104/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LTGEFDYKELMDGSKVPTEFPNLRGCICKVRPC--IRICCARKNILSNGECSDGVKNEIKL---- 114
            :||:.....:.||:.:.          ||.:.|  .|:.....|::.........|..:.|    
Zfish   154 ITGDLKGNYIFDGAHIN----------CKEKFCDEARLKPRGANMIEEVVMRFNAKGRVDLPCAQ 208

  Fly   115 -TMLDL----TMQDILLTDPTLAELNMIPQ--------------------YNSTELLILREQFQP 154
             |::::    |..:..:..|...:.|.||.                    |...:.|..|...:.
Zfish   209 GTVIEMDEEFTGHNFTVPAPRFVDANTIPSVYIPSSLRSVSRRKSKVVCTYYKNKTLFERGPSKS 273

  Fly   155 C--DEIVSLKRDEYTI---LKDGSILLH-------TSAEILS-----------NDQYCLYPEIYS 196
            .  |:||.|..:..||   ::...|..|       :|...:|           .|..|       
Zfish   274 ALLDDIVGLSVENETIRNLIEPVKIRFHHRPFAPDSSGRCVSWDTKQDNEVNWKDDGC------- 331

  Fly   197 DFPETIRI--------INRRCYRNVMPGIAQ---------LSVISVVGFILTLA-----VYLSVE 239
               :|::|        .|...|..::..:.|         |:.|:.||..::|.     .|...:
Zfish   332 ---DTVKINEEQTECHCNHLTYFAILVQVEQKSTVRHLKALTFITAVGCAVSLVSCLVLFYWLCK 393

  Fly   240 KLR------NLLGKCLICSLFSMFMEYFIWTMDYFRLL-QSICSAAGYMKYFFSMSSYLWFSVVS 297
            :.|      :|:.:.|:.::|.:.: :||.|.....:. :::|...|.:.::..:|:..|.::..
Zfish   394 RRRGKKNQISLVHRGLVVAIFLLCL-FFILTGILANVANETVCQLTGSLLHYGLLSTLCWMAMEV 457

  Fly   298 FHLWEL 303
            ||.:.|
Zfish   458 FHTFLL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 35/214 (16%)
adgrg1NP_001018317.1 GPS 312..354 CDD:280071 7/51 (14%)
7tm_4 369..611 CDD:304433 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.