DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgrg5

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_008770523.1 Gene:Adgrg5 / 307645 RGDID:1305559 Length:564 Species:Rattus norvegicus


Alignment Length:197 Identity:38/197 - (19%)
Similarity:74/197 - (37%) Gaps:57/197 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 YSDFPETIRIINRRCYRNVMPGIA---QLS--------------------VISVVGFILTLAVYL 236
            |::.|...:::   |:.|.:...|   |||                    .||:|..:||:.:..
  Rat   206 YTEQPSPTQVL---CHCNHLTYFAVLMQLSGDPVPTELQTPLEYISLVGCSISIVASLLTILLNA 267

  Fly   237 SVEKLR--------NLLGKCLICSLFSMFMEYFIWTMDYFRLLQSICSAAGYMKYFFSMSSYLWF 293
            ...||.        ||.|..|:.::..:.....:..    .:.:|:|:......::..:||..|.
  Rat   268 HSRKLSDSTTRIHLNLNGSVLLLNITFLLSSQMVPP----TVPRSVCTVLAATLHYALLSSLTWM 328

  Fly   294 SVVSFHLWELFTSLNRHEPQYRFLIYNTFV--------WCTAAIPTVVIFSMNQMWENDPGKSEW 350
            .|..|:|:.|   |.|        :||.::        ..::....:.:::|..::...|||...
  Rat   329 GVEGFNLYLL---LGR--------VYNVYIRRVSSPLGAASSDDQELSVWTMCDLFLQKPGKWYR 382

  Fly   351 LP 352
            ||
  Rat   383 LP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 2/13 (15%)
Adgrg5XP_008770523.1 GPS 184..228 CDD:396408 5/24 (21%)
7tm_GPCRs 243..>349 CDD:421689 24/120 (20%)
TM helix 1 243..268 CDD:410628 5/24 (21%)
TM helix 2 277..299 CDD:410628 4/21 (19%)
TM helix 3 311..338 CDD:410628 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.