DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgrg3

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_038954076.1 Gene:Adgrg3 / 291854 RGDID:1305674 Length:574 Species:Rattus norvegicus


Alignment Length:276 Identity:51/276 - (18%)
Similarity:111/276 - (40%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SVISVVGFILTLAVYL----SVEKLRN----LLGKCLICSLFSMFMEYFIWTMDYFRLLQSICSA 277
            |.:|::....|:.:|:    |:::.::    .:...|..|||.:.:.:.|......:...:.|..
  Rat   303 SAVSMIFLAFTMVLYVAFRFSLQRFKSEDAPKIHMALSTSLFLLNLTFLINVGSGSQGPPASCWV 367

  Fly   278 AGYMKYFFSMSSYLWFSVVSFHLWELFTSL-NRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMW 341
            ...:.::|.:..:.|..:.:|||:.|...: |.:...| ||..:...|   .:|.:::..:    
  Rat   368 RAAIFHYFLLCVFTWMGLEAFHLYLLVIKVFNTYFGHY-FLKLSLLGW---GLPVLIVIGV---- 424

  Fly   342 ENDPGKSEWLPLVGYFGCSVKDWNSSS-----WFYSHIPI-VILNSFNVIMF----VLTAIYIWK 396
                |.|.     .|...:::|..:.:     ||.....: ..::.:.::.|    |:.|:..||
  Rat   425 ----GSSN-----SYGVYTIRDQENRTSLELCWFQKEPALYATVHGYFLVTFLFGAVVLAMVAWK 480

  Fly   397 VKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTV 461
            :.......|...:..|.      ::.:..:.|..::|.:|.|..||.|.      |.|:.  :..
  Rat   481 IFTLPSVTAGKGQGQTW------KSVLTVLGLSSLVGMTWGLAVLTPLG------LSTVY--IFT 531

  Fly   462 YLNAAFGILIFVLLIL 477
            .||:..|:.||...|:
  Rat   532 LLNSLQGLFIFCWFII 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
Adgrg3XP_038954076.1 GPS 244..282 CDD:396408
7tm_GPCRs 292..551 CDD:421689 51/276 (18%)
TM helix 1 294..319 CDD:410628 4/15 (27%)
TM helix 2 333..355 CDD:410628 5/21 (24%)
TM helix 3 366..393 CDD:410628 5/26 (19%)
TM helix 4 406..426 CDD:410628 4/30 (13%)
TM helix 5 454..481 CDD:410628 4/26 (15%)
TM helix 6 495..522 CDD:410628 7/32 (22%)
TM helix 7 524..549 CDD:410628 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.