DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgrg7

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_766413.2 Gene:Adgrg7 / 239853 MGIID:2441732 Length:785 Species:Mus musculus


Alignment Length:330 Identity:60/330 - (18%)
Similarity:133/330 - (40%) Gaps:76/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 FPETIRIINRRCYRNVMPGIAQLSVISVVGFILTLAVYLSVEKLRN------LLGKCLICSLFSM 256
            :|:::.|::     |:  |.|    :|:.|..||:...:...|:|.      |:..|....:|::
Mouse   427 YPKSLDILS-----NI--GCA----LSIAGLALTILFQILTRKIRKTSVTWVLVSLCSSMLIFNL 480

  Fly   257 FMEYFIWT-----------------------MDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSF 298
            ...:.|..                       .|........|:|...:.::|.:.::.|..:.:.
Mouse   481 LFVFGIENSNKNLKTSDSDINVKPENNKIPESDTIETPNPSCTAIAALLHYFLLVTFTWNGLSAT 545

  Fly   299 HLWELFTSLNRHEPQYRFLIYNTFV-WCTAAIPTVV-------IFSMN---QMWENDPGKSE--W 350
            .|:.|.....:..|:: |:|:.:.| |   .:|.::       |::::   :.||.|..:.|  |
Mouse   546 QLYFLLIRTMKPLPRH-FIIFISLVGW---GVPAIIVGVTIGSIYALSGNKRYWELDYRQEEICW 606

  Fly   351 LPLVGYFGCSVKDWNSSSWFYSH-IPIVILNSFNVIMFV-LTAIYIWKVKKGVKSFAQHDERNTT 413
            |.:.     ...|:..|...:|. ||:.|:...|:.:|| :|...:||..:.:.|         |
Mouse   607 LAVP-----KDNDYARSPLLWSFIIPVTIILITNITIFVIITVKVLWKNNQNLTS---------T 657

  Fly   414 CLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFVLLILK 478
            ....:::.....:.:.::.|.:|:|.....::.|...::.:.:..|   .|...|:.||:|..::
Mouse   658 KKVSSLKKVFSTLSIAVVFGVTWILAYAMLISNDDIRIVFSYIFCL---FNTTQGLQIFILYTVR 719

  Fly   479 GSTFK 483
            ...|:
Mouse   720 TKVFQ 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 2/10 (20%)
Adgrg7NP_766413.2 GPS 380..418 CDD:280071
7tm_4 430..710 CDD:304433 54/311 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.