DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRF2

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:501 Identity:81/501 - (16%)
Similarity:156/501 - (31%) Gaps:207/501 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TMQDILLTDPTLAELNMIPQYNSTELLILREQFQPCDEIVSLKR----DEYTI-LKDGSILLHTS 179
            |:.:.:|...:::....||..||:.:|:        ..:.|..|    |::.: :.|  :.:||.
Human   239 TIANHILNSKSISNWTFIPDRNSSYILL--------HSVNSFARRLFIDKHPVDISD--VFIHTM 293

  Fly   180 AEILSNDQYCLYPEIYSDFPETIRI------------INRRCYRNVMPGIAQLSVISV----VGF 228
            ...:|.|      .|..:|..::||            |:|...|.| |..:|  |||:    :|.
Human   294 GTTISGD------NIGKNFTFSMRINDTSNEVTGRVLISRDELRKV-PSPSQ--VISIAFPTIGA 349

  Fly   229 ILTLAVYLSV------------------------------------------------------E 239
            ||..::..:|                                                      |
Human   350 ILEASLLENVTVNGLVLSAILPKELKRISLIFEKISKSEERRTQCVGWHSVENRWDQQACKMIQE 414

  Fly   240 KLRNLLGKCLICSLFSMF----------------------------------MEYFIWT------ 264
            ..:..:.||....||:.|                                  :|..:|:      
Human   415 NSQQAVCKCRPSKLFTSFSILMSPHILESLILTYITYVGLGISICSLILCLSIEVLVWSQVTKTE 479

  Fly   265 MDYFR-----------LLQSI-----------------CSAAGYMKYFFSMSSYLWF----SVVS 297
            :.|.|           |:..:                 |.||.:..:||.:|.:.|.    .::.
Human   480 ITYLRHVCIVNIAATLLMADVWFIVASFLSGPITHHKGCVAATFFVHFFYLSVFFWMLAKALLIL 544

  Fly   298 FHLWELFTSLNRHEPQYRFLIYNTF---VWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGC 359
            :.:..:|.:|.:     ..|:.:.|   ..|..||..:.:.:      .:|||....|.:.:.  
Human   545 YGIMIVFHTLPK-----SVLVASLFSVGYGCPLAIAAITVAA------TEPGKGYLRPEICWL-- 596

  Fly   360 SVKDWNSSSWFYSH-IPIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYI 423
               :|:.:....:. ||.:.:...|:|...|..:...:...|...|.:            |:..:
Human   597 ---NWDMTKALLAFVIPALAIVVVNLITVTLVIVKTQRAAIGNSMFQE------------VRAIV 646

  Fly   424 QFVR----LFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNA 465
            :..:    |..::|.:|.....|.:  |...|...|:.:|   |||
Human   647 RISKNIAILTPLLGLTWGFGVATVI--DDRSLAFHIIFSL---LNA 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 21/105 (20%)
ADGRF2NP_001355044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.