DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and lat-2

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001040724.1 Gene:lat-2 / 173771 WormBaseID:WBGene00002252 Length:1338 Species:Caenorhabditis elegans


Alignment Length:275 Identity:66/275 - (24%)
Similarity:120/275 - (43%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GIAQ-LSVISVVG-----FILTLAV-----YLSVEKLRNLLGKCL-ICSLFSMFMEYFIWTMDYF 268
            |:|. |.|:|.:|     ..|.|:|     :.:::.:||.:.:.| :|.|.:..:  |:..||..
 Worm   892 GLASALDVVSTIGCAISIVCLALSVCVFTFFRNLQNVRNSIHRNLCLCLLIAELV--FVIGMDRT 954

  Fly   269 RLLQSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEP-QYRFLIYNTFVWCTAAIPTV 332
            . .::.|.....:.::|.:||:.|..:..:.|:.:...:  .|| :.|..:|..|.:.|.|:  |
 Worm   955 G-NRTGCGVVAILLHYFFLSSFCWMLLEGYQLYMMLIQV--FEPNRTRIFLYYLFCYGTPAV--V 1014

  Fly   333 VIFSMNQMWENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKV 397
            |..|....|| |.|...:        |.:.....:.|.:. .||:::.:.|:| |:|.|:   ||
 Worm  1015 VAISAGIKWE-DYGTDSY--------CWIDTSTPTIWAFV-APIIVIIAANII-FLLIAL---KV 1065

  Fly   398 KKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVY 462
            ...|:|      |:.|.....:........|..::|.:|:...||.:...:    .|....:...
 Worm  1066 VLSVQS------RDRTKWGRIIGWLKGSATLLCLLGITWIFGFLTAVKGGT----GTAFAWIFTI 1120

  Fly   463 LNAAFGILIFVLLIL 477
            ||...||.||||.::
 Worm  1121 LNCTQGIFIFVLHVV 1135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
lat-2NP_001040724.1 CLECT 52..193 CDD:214480
Gal_Lectin 242..322 CDD:280328
CLECT 330..>399 CDD:295302
HormR 479..542 CDD:214468
GAIN 556..>660 CDD:293098
GPS 837..884 CDD:197639
7tm_4 894..1129 CDD:304433 61/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.