DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and Adgrl4

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_573485.2 Gene:Adgrl4 / 170757 MGIID:2655562 Length:739 Species:Mus musculus


Alignment Length:322 Identity:72/322 - (22%)
Similarity:141/322 - (43%) Gaps:61/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DGSILLHTSAEILSNDQY----CLYPEIYSDFPETIRIINRRCYRNVMPGIAQL----SVISVVG 227
            :|..|.|      |||.:    |.:...::....:...|..:.| |::..|.||    |:|.:..
Mouse   436 EGCELTH------SNDTHTSCRCSHLTHFAILMSSTSSIGIKDY-NILTRITQLGIIISLICLAI 493

  Fly   228 FILTLAVYLSVEKLRNLLGKCLICSLFSMFMEYFIW-TMDYFRLLQSICSAAGYMKYFFSMSSYL 291
            .|.|...:..::..|..:.|.|.||||...:.:.|. .::..:|:.||  .||.:.||| ::::.
Mouse   494 CIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLIGININTNKLVCSI--IAGLLHYFF-LAAFA 555

  Fly   292 WFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGY 356
            |..:...||:.:...:..::   .||..|.:::...:...||.||.:..:.             |
Mouse   556 WMCIEGIHLYLIVVGVIYNK---GFLHKNFYIFGYLSPAVVVGFSASLGYR-------------Y 604

  Fly   357 FGCSVKDWNS--SSWFYSHI-PIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFN 418
            :|.:...|.|  :::.:|.| |..::...|::.|.:....:::...|:|.       ..:|.| |
Mouse   605 YGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHTAGLKP-------EVSCYE-N 661

  Fly   419 VQTYIQ-FVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYL----NAAFGILIFVLL 475
            :::..: .:.|..::|.:|:...|       |::..::|   |.||    ||..|:.||:.|
Mouse   662 IRSCARGALALLFLLGTTWIFGVL-------HVVHASVV---TAYLFTVSNAFQGMFIFLFL 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 8/41 (20%)
Adgrl4NP_573485.2 EGF_CA 58..91 CDD:214542
EGF_CA 108..141 CDD:214542
GAIN 190..370 CDD:293098
GPS 417..461 CDD:280071 7/30 (23%)
7tm_4 473..709 CDD:304433 61/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.