DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRF3

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001138640.1 Gene:ADGRF3 / 165082 HGNCID:18989 Length:1079 Species:Homo sapiens


Alignment Length:309 Identity:58/309 - (18%)
Similarity:111/309 - (35%) Gaps:86/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PGIAQLSVISVVGFILTLAVYLSVEKLRNLLGKCLICSLFSMFMEYFIWTMDYFRLLQS------ 273
            |.:|.|:.:.:...||.|.|.|.|..   |:.:.::.:..|.|....:..| .|.||.:      
Human   768 PALALLTQVGLGASILALLVCLGVYW---LVWRVVVRNKISYFRHAALLNM-VFCLLAADTCFLG 828

  Fly   274 -----------ICSAAGYMKYFFSMSSYLWF----SVVSFHLWELFTSLNRHE--PQYRFLIYNT 321
                       :|.||.::.:|..::::.|.    .|::..|..:|..|.:|.  |....|.|  
Human   829 APFLSPGPRSPLCLAAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLGY-- 891

  Fly   322 FVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVKDWNSSSW-------FYSHI-PIVI 378
              .|...:..|.:             ..:||...|..      ....|       .|:.: |::.
Human   892 --LCPLGLAGVTL-------------GLYLPQGQYLR------EGECWLDGKGGALYTFVGPVLA 935

  Fly   379 LNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIM----GASWLLD 439
            :...|.::..:..:.:  ::..:......::|         |..:..::..||:    |.:|.|.
Human   936 IIGVNGLVLAMAMLKL--LRPSLSEGPPAEKR---------QALLGVIKALLILTPIFGLTWGLG 989

  Fly   440 QLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFVLLILKGSTFKMIMER 488
            ..|.|.|     :.|:...:...||...|  :|:||      |..:|:|
Human   990 LATLLEE-----VSTVPHYIFTILNTLQG--VFILL------FGCLMDR 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
ADGRF3NP_001138640.1 HRM 431..477 CDD:280888
GPS 713..758 CDD:280071
7tm_4 770..1016 CDD:304433 51/290 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.