DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and ADGRG4

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_722576.3 Gene:ADGRG4 / 139378 HGNCID:18992 Length:3080 Species:Homo sapiens


Alignment Length:295 Identity:65/295 - (22%)
Similarity:109/295 - (36%) Gaps:79/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSVISVVG-----FILTLAV--YLSVEKLR-NLLGKCLI--CSLFSMFMEYFI---WTMDYFRLL 271
            |::|:..|     ..|.:||  |::..||| :...|.||  |:...|....|:   |...:.:: 
Human  2743 LALITYTGCGISSIFLGVAVVTYIAFHKLRKDYPAKILINLCTALLMLNLVFLINSWLSSFQKV- 2806

  Fly   272 QSICSAAGYMKYFFSMSSYLWFSVVSFHLW-ELFTSLNRHEPQY--RFLIYNTFVWCTAAIPTVV 333
             .:|..|....::|.:.|:.|..:.:.|:: .|....|.:.|.|  :|.:..   |...||...:
Human  2807 -GVCITAAVALHYFLLVSFTWMGLEAVHMYLALVKVFNIYIPNYILKFCLVG---WGIPAIMVAI 2867

  Fly   334 IFSMNQMWENDPGKSEWLPLVGYFG-----CSVKDWNSSSWFYSHIPIV----ILNSFNVIMFVL 389
            ..|:.:            .|.|...     |.:||   .|.||  |.:|    ::...|:.||..
Human  2868 TVSVKK------------DLYGTLSPTTPFCWIKD---DSIFY--ISVVAYFCLIFLMNLSMFCT 2915

  Fly   390 TAIYIWKVKKGV----KSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHL 450
            ..:.:..||..:    :....||.:.|..|.|             ::|.:|          ....
Human  2916 VLVQLNSVKSQIQKTRRKMILHDLKGTMSLTF-------------LLGLTW----------GFAF 2957

  Fly   451 LLDTIVLNLTVYLNAAF----GILIFVL-LILKGS 480
            .....:.|..:||.|.|    |..|||. .::|.|
Human  2958 FAWGPMRNFFLYLFAIFNTLQGFFIFVFHCVMKES 2992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
ADGRG4NP_722576.3 LamG 28..210 CDD:304605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 946..965
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1274..1348
CytochromB561_N <1668..>1909 CDD:286826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2109..2141
GPS 2684..2727 CDD:280071
7tm_2 2743..2982 CDD:278432 60/283 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3051..3080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.