DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and LOC103911493

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_021326603.1 Gene:LOC103911493 / 103911493 -ID:- Length:301 Species:Danio rerio


Alignment Length:249 Identity:50/249 - (20%)
Similarity:92/249 - (36%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VMPGIAQLSVISVVG-----FILTLAVYLS--VEKLR-NLLGKCLICSLFSMFM--------EYF 261
            |.|.:..|::||.||     |.|.:|:::.  :.|.: |...|.||..|.::|.        |..
Zfish    11 VAPYLDSLTLISSVGCGISVFFLAIALFMHFLLRKAKSNQATKILINILVALFFLNVSFLSNESV 75

  Fly   262 IWTMDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCT 326
            ..:.|     ::.|.....:.::..::::.||.:.:.|::......|.....|...|  |.:...
Zfish    76 ANSGD-----KNACVFIALLMHYSMLTTFTWFFIQALHMYLWLIRQNVTITNYMRKI--TVLGWG 133

  Fly   327 AAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVKDWNSS----SW----FYSHIPIVILNSFN 383
            .::|.||..               |...||...::...:..    .|    |..:  ||.:..::
Zfish   134 VSMPIVVAV---------------LSTGGYKAVTLSSTSGKIARMCWITDLFIQY--IVNIGFYS 181

  Fly   384 VIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFV-RLFLIMGASW 436
            ::....|.|:|..|   ...|...|.|.|.......:..:..| .||.:.|.:|
Zfish   182 LVFIFTTIIFIISV---TNIFQSRDIRATEGKRLTFRKQLMMVLSLFFLFGLTW 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
LOC103911493XP_021326603.1 7tm_GPCRs 18..265 CDD:333717 48/242 (20%)
TM helix 1 18..42 CDD:320095 8/23 (35%)
TM helix 2 52..73 CDD:320095 5/20 (25%)
TM helix 3 85..107 CDD:320095 2/21 (10%)
TM helix 4 126..142 CDD:320095 5/17 (29%)
TM helix 5 169..192 CDD:320095 5/24 (21%)
TM helix 6 215..240 CDD:320095 5/18 (28%)
TM helix 7 244..265 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.