DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgre9

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_021333151.1 Gene:adgre9 / 101883848 ZFINID:ZDB-GENE-121214-61 Length:660 Species:Danio rerio


Alignment Length:391 Identity:81/391 - (20%)
Similarity:149/391 - (38%) Gaps:78/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KNEIKL---TMLDLTM---QDILLTDPTLAELNMIPQYNSTELLILREQFQPCDEIVSLKRDEYT 167
            :|.:|.   |::..|:   .:..||.|....|..|..:|....|          ..|.....|:.
Zfish   294 ENTVKTMMSTVISATLSQTNNTALTKPVNFTLKHIQGFNPKSSL----------SCVYWNDSEWI 348

  Fly   168 ILKDGSILL-----HTSAEILSNDQYCLYPEIYSDFPET---IRIINRRCYRNVMPGIAQLSVIS 224
            :  ||..:|     ||....:....:.|..:..|..||:   :.::|..|.           ::.
Zfish   349 V--DGCSVLNSNSSHTVCSCVHLSTFALIMQTSSTPPESSDLLELLNLVCV-----------IVG 400

  Fly   225 VVGFILTLAVYLSVEKLR-----NLLGKCLIC-SLFSMFMEYFIWTMDYFRLL---QSICSAAGY 280
            :|.|.|.|   ||....:     |.:.:..|| ||.|..: .|:.|..:..|:   |..|.|...
Zfish   401 LVFFSLAL---LSFALCQWSPGVNNVARINICISLLSAHL-LFLLTQQFLSLIRPQQVFCVAIAG 461

  Fly   281 MKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDP 345
            :.:|..:|:::|..:.:..|:....:|:|...:.:.::.:.|:.....:..:|:.          
Zfish   462 LLHFLFLSAFVWMFIEAVLLFICVQNLSRISSKKKEVLSSGFLCVIGYVLALVVV---------- 516

  Fly   346 GKSEWLPLVGYFG--CSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHD 408
            |.|..|...||..  |.:|......|.:.. |:.::.:.|.|.|:...:.:....|.:.:... .
Zfish   517 GVSIGLVPEGYGSEQCWIKTAEGFIWSFLG-PVCVILALNTIFFIKIVLTLNSTLKNLNAEVS-Q 579

  Fly   409 ERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFV 473
            .:.|..|.|  :|..|||    ::|..|:|......:|...:|.        :.||:..|..|||
Zfish   580 MKQTKILAF--KTLSQFV----VLGCPWILGFFINGSEVLEILF--------LVLNSQQGTFIFV 630

  Fly   474 L 474
            :
Zfish   631 I 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 23/113 (20%)
adgre9XP_021333151.1 GPS 335..380 CDD:197639 9/56 (16%)
7tm_GPCRs 389..648 CDD:333717 59/284 (21%)
TM helix 1 389..413 CDD:320095 8/37 (22%)
TM helix 2 422..443 CDD:320095 6/21 (29%)
TM helix 3 457..479 CDD:320095 4/21 (19%)
TM helix 4 503..519 CDD:320095 3/25 (12%)
TM helix 5 537..560 CDD:320095 4/23 (17%)
TM helix 6 584..609 CDD:320095 9/30 (30%)
TM helix 7 611..636 CDD:320095 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.