DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgrg2a

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005162818.2 Gene:adgrg2a / 101882832 ZFINID:ZDB-GENE-140106-206 Length:2289 Species:Danio rerio


Alignment Length:286 Identity:55/286 - (19%)
Similarity:124/286 - (43%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KDGSILLHTSAEILSNDQYCLYPEIYSDFPETIRI----INRRCYRNVMPGIAQLSV-ISVVGFI 229
            :||..::::|.|   |:..|....:.| |...:.|    :..|....::..|:.:.. :|.:...
Zfish  1887 RDGCSVMNSSTE---NETICSCSHLTS-FAVLMDISQQGVTDRMQATILTFISYIGCGVSAIFLS 1947

  Fly   230 LTLAVYLSVEKL-RNLLGKCLICSLFSMFMEYFIWTMDYFRLLQS----ICSAAGYMKYFFSMSS 289
            :||..|||.:|: |::..|.||...|::.....::.:|.:..|.:    :|.:..:..::|.:.|
Zfish  1948 VTLLTYLSFDKIRRDIPSKILIHLCFALLFLNLVFLLDSWLALYTDAVGLCISTAFFLHYFLLVS 2012

  Fly   290 YLWFSVVSFHLW-ELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPL 353
            :.|..:.:.|:: .:....|....:| .|.::...|.......:::.::|:       .:..|..
Zfish  2013 FTWMGLEALHMYLAIVKVFNNFMSRY-MLKFSLIGWGVPLAVVIIVIAINK-------DNYGLIS 2069

  Fly   354 VGYFGCSVKD---W--NSSSWFYSHIP-IVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNT 412
            .|.|.....|   |  ||::::.:.:. ..|:...|:.|||:..:::.::|:          ||.
Zfish  2070 YGKFSDGTTDDFCWLKNSTAFYVAVVAYFCIIFVLNLAMFVVVMVHLRRIKR----------RNP 2124

  Fly   413 TCLEF--NVQTYIQFVRLFLIMGASW 436
            ...::  .||.......|..::|.:|
Zfish  2125 HNNQYRSGVQDLRSIAGLTFLLGLTW 2150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 9/42 (21%)
adgrg2aXP_005162818.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.