DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgre13

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_021327151.1 Gene:adgre13 / 100538238 ZFINID:ZDB-GENE-150505-3 Length:303 Species:Danio rerio


Alignment Length:281 Identity:64/281 - (22%)
Similarity:119/281 - (42%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSVISVVGFILTLAVYLSVEKLR----------NLLGKCLICSLFSMFMEYFIWTMDYFRLL--- 271
            |:|::||..|:.| ::.|:..|.          |.:.:..||....:....|:.|..:..|:   
Zfish    15 LNVLNVVCVIVGL-LFFSLALLTFAFCQWGPGVNNVARINICISLLLAHLLFLLTQQFLSLIRRQ 78

  Fly   272 QSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTA--AIPTVVI 334
            |.:|.....:.:|..:|.::|..:.:..|:....:|::...|.|.::.|.|: |..  |:..||:
Zfish    79 QMLCEVISGLLHFLFLSGFVWMFIEAVLLFICVKNLSQISSQKRNVLRNIFL-CVIGYAVALVVV 142

  Fly   335 FSMNQMWENDPGKSEWLPLVGYFG--CSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKV 397
                       |.|..:...||..  |.:|......|.:.. |:.::.:.|||:|:...:   .:
Zfish   143 -----------GISAAVVPKGYGSEKCWIKMDKGFIWSFLG-PVTVILALNVILFIGIGV---SL 192

  Fly   398 KKGVKSFAQHDERNTTCLEFNVQTYIQFVRL--FLIMGASWLLDQLTRLAEDSHLLLDTIVLNLT 460
            |...|..      |....:.|....|.|..|  |:::|.||:|...|    :|..:|:.:.|   
Zfish   193 KSAFKKL------NADVSQLNQTKIIMFKTLAQFVVLGCSWILGFFT----NSSKVLEILFL--- 244

  Fly   461 VYLNAAFGILIFVL--LILKG 479
             .||:..|..||::  ::.||
Zfish   245 -ILNSQQGTFIFLIYCVLNKG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
adgre13XP_021327151.1 7tm_GPCRs 12..274 CDD:333717 64/281 (23%)
TM helix 1 15..39 CDD:320095 8/24 (33%)
TM helix 2 48..69 CDD:320095 3/20 (15%)
TM helix 3 83..105 CDD:320095 3/21 (14%)
TM helix 4 129..145 CDD:320095 6/27 (22%)
TM helix 5 163..186 CDD:320095 5/23 (22%)
TM helix 6 210..233 CDD:320095 8/22 (36%)
TM helix 7 237..262 CDD:320095 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.