DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and adgrf11

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:430 Identity:76/430 - (17%)
Similarity:150/430 - (34%) Gaps:144/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NSTELLILREQFQPCDEIV-------SLKRDEYT----------------------ILKDGSILL 176
            |||..:::::..:|....:       |:....||                      .|::.|.:.
Zfish   244 NSTTEILIQQVLKPTSLTIIILTTLHSILPARYTANGKGKPDVRINGDVVVVKVNQTLQNISFVF 308

  Fly   177 HTSAEILSNDQYCLY------------PEIYSDFPETIRIINRRCYRN--------VMP------ 215
            .|:.:.|.|.| |::            .|:..:..|..:|....|..|        :.|      
Zfish   309 DTTEQSLGNPQ-CVFWNFHLSTWDSTGCEVKPNLSEEEKIDKITCECNHTTSFSLLMSPFFIDDK 372

  Fly   216 ----------GIAQLSVISVVGFILTLAVYLSVEK-----LRNLLGKCLICSLFSMFMEYFIWTM 265
                      ||:.||:  |:..|:...|:.:|.|     ||::   ||:.:..|:.:....   
Zfish   373 ALDYITYTGLGISVLSL--VISLIIGAIVWTTVTKSNSAYLRHV---CLVNTNVSLLVADVC--- 429

  Fly   266 DYFRLLQSI-----------CSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIY 319
              |.:..||           |:|..:..:.|.::.:.|..:.:..|..:.|.:.....:.:.:..
Zfish   430 --FIIGASIVQPGQLAPVGPCTAVAFSMHLFFLAFFFWMLISAMLLLYMTTMVYSQMSRAKMMAI 492

  Fly   320 NTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVKD----------W-NSSSWFYSH 373
            ..|:...|.:..|||                     .:|.:.::          | |........
Zfish   493 AFFLGYGAPLLIVVI---------------------TYGLTAREGKYILEADVCWLNFDETKALQ 536

  Fly   374 IPIVILNSFNVIMFVLTAIYIWK---VKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFL--IMG 433
            |.:.:.:||..:..::..:.::|   |:|         ::|.   |.|:...:..|.|.:  :.|
Zfish   537 IFVSLASSFTAVNVLIIIVVLYKMLIVRK---------QQNK---ETNILPTVTRVVLIVSPLFG 589

  Fly   434 ASWLLDQLTRLAED--SHLLLDTIVLNLTVYLNAAFGILI 471
            .:|.|...|.|:.|  .||:. ||:.:|....|...|:|:
Zfish   590 VTWGLGIGTMLSPDYGIHLVF-TILNSLQGIFNLVSGLLV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 17/108 (16%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071 7/45 (16%)
7tm_4 374..620 CDD:304433 53/289 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.