DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl12 and gpr157

DIOPT Version :9

Sequence 1:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001124512.1 Gene:gpr157 / 100038048 XenbaseID:XB-GENE-492646 Length:323 Species:Xenopus tropicalis


Alignment Length:180 Identity:36/180 - (20%)
Similarity:72/180 - (40%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VISVVGFILTLAVYLSVEKLRN----LLGKCLICSLFSMFMEYFIWTMDYFRLLQSICSAAGYMK 282
            |:|.:|..|.:..|:..:.||:    ||....:..|.|. :.||...:..|:.....|...|.:.
 Frog    24 VLSFLGSALIIVTYILWQDLRSRPRLLLLFLSVADLLSA-LSYFYGVLRNFQDSTWDCVTQGAIS 87

  Fly   283 YFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGK 347
            .|.:.||:.|...|:.:   |:.::.:.:..:...|.......:..:|.|:..|           
 Frog    88 TFSNTSSFFWTVAVAVY---LYITIVKSQQSFADQIIPWLHLISWGVPLVITLS----------- 138

  Fly   348 SEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKV 397
            :..|..:||....|    |..|.:..|.:.     :.::::|.|..:|::
 Frog   139 AVCLKKIGYDASYV----SVGWCWVKIDVE-----DKLLWMLLAGKVWEI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145
gpr157NP_001124512.1 7tm_GPCRs 17..>192 CDD:391938 36/180 (20%)
TM helix 1 17..39 CDD:341315 5/14 (36%)
TM helix 2 48..69 CDD:341315 6/21 (29%)
TM helix 3 81..103 CDD:341315 6/21 (29%)
TM helix 4 123..139 CDD:341315 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.