DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSL1D1 and CG13096

DIOPT Version :9

Sequence 1:NP_056474.2 Gene:RSL1D1 / 26156 HGNCID:24534 Length:490 Species:Homo sapiens
Sequence 2:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster


Alignment Length:429 Identity:100/429 - (23%)
Similarity:181/429 - (42%) Gaps:76/429 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     6 SASLSSAAATGTSTSTPAAPTARKQ--------------LDKEQVR-----------KAVDALLT 45
            ::.|...|......|.||:|...|:              ::||..:           ||.|....
  Fly   201 ASQLQKKAKAVQKLSKPASPPKSKKALSKSKPGQAKGNAVNKEPAKSKKPVELTFELKAFDEKRF 265

Human    46 HCKSRKNNYGLLL-------------NENESLF------LMVVLWKIPSKELR-VRLTLPHSIRS 90
            |....:||...:.             .:|.|:|      |.|..:||||...| |:|.|.||:..
  Fly   266 HEIVNENNVTKVCAALKSVVSEEVEKKKNTSIFSDYRYVLQVCSYKIPSCPKRMVKLNLKHSLVG 330

Human    91 DSEDICLFTKDEPNSTP---EKTEQFYRKLLNKHGIKTVSQIISLQTLKKEYKSYEAKLRLLSSF 152
            ..:|:.|...|......   :.|:|.|..:|.:.|:|....::....|:.|..|:|||.:.|:|:
  Fly   331 KDDDVALIVPDLQRGAKFDYDPTKQHYEDMLREAGVKQRLTVVPFNQLRNEMGSFEAKRKFLNSY 395

Human   153 DFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKN--LSREINDCIGGTVLNISKSGSCSAIR 215
            |:.|.|.|:.....:.:|::..:.:.|..|:.|...|  |.:|:...:..|.......|...|:.
  Fly   396 DYLLCDGRLSGQATAFLGKNTQKPRNVLHSLRLSKDNDKLPQEVTRALTRTAFRQLSKGDLIAVP 460

Human   216 IGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKTE--KSAALPIFSSFVSNWDE----- 273
            :|:..:..|.:.|||:.|.|.|.|..|....:::.:::|.:  .::|||::.|..:..::     
  Fly   461 VGNHEITAEQLAENILLVIKQLQEVYPGGLANIRSMYLKIDITGTSALPLYVSMCAPPEDVPYVV 525

Human   274 ATKRSLLNKKKKEARR------KRRERNFEK-QKERKKKRQQARKTASVLSKDDVAP---ESGDT 328
            ..:...:.|.||:|..      ..::..|.| ..::.|::.|.||..:.|...|.||   :.||.
  Fly   526 GPREQRMLKLKKQANEVLSKFAMTKDAEFIKLTSDQVKRKAQLRKEKAALLAADAAPKDNDGGDA 590

Human   329 TVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQ 367
            .|...:::||.:.|         .|:..|.::.|:|:.:
  Fly   591 AVPAKKARKESSSE---------GAKADAESDEEEEVEE 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSL1D1NP_056474.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 7/40 (18%)
Ribosomal_L1 36..263 CDD:238235 65/264 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..490 24/98 (24%)
DUF4045 <324..>462 CDD:330572 10/44 (23%)
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8337
eggNOG 1 0.900 - - E1_KOG1685
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1000750at2759
OrthoFinder 1 1.000 - - FOG0002135
OrthoInspector 1 1.000 - - oto89635
orthoMCL 1 0.900 - - OOG6_102551
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1115
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.