DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and GAS7

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_958839.1 Gene:GAS7 / 8522 HGNCID:4169 Length:476 Species:Homo sapiens


Alignment Length:285 Identity:70/285 - (24%)
Similarity:130/285 - (45%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYFWGEKNN--------GYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKA---- 59
            ||||.:|.:        |:::|......|....||:|||:||:..|||..:|.::||:..:    
Human   202 DYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQ 266

  Fly    60 --GTLNSTFAPVWTILRTSAEKLSTLHLQMVQKL-TELVKDVAKYADELHKKHKS----VKEEES 117
              |:|...:|.|...|...||    :||:...|| :|:.|.:..:.:...|..|.    :.:...
Human   267 EEGSLGEAWAQVKKSLADEAE----VHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRK 327

  Fly   118 QTLECVQAIQTSTVAV-QKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKALLDKH 181
            |......:::.:..|: ::.||| ..|.|:|| ::..|.:.:|.:|...|..:..::....:|.:
Human   328 QLASRYASVEKARKALTERQRDL-EMKTQQLE-IKLSNKTEEDIKKARRKSTQAGDDLMRCVDLY 390

  Fly   182 NPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDK 246
            |..::::...|..|....:.:|...:..:::.|..|.: |::..||       |.:..|: .||:
Human   391 NQAQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQ-LRHETDM-------FNQSTVE-PVDQ 446

  Fly   247 LL---------EQFVLNKYTGLEKP 262
            ||         |.:|....||..:|
Human   447 LLRKVDPAKDRELWVREHKTGNIRP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 66/281 (23%)
Apolipoprotein 52..214 CDD:279749 35/173 (20%)
AP_Syp1_like_MHD 928..1194 CDD:271171
GAS7NP_958839.1 SH3_GAS7 5..57 CDD:212763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..171
WW_FCH_linker 109..201 CDD:374680
F-BAR_GAS7 214..446 CDD:153333 57/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2080
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.