DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and gas7a

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001265748.1 Gene:gas7a / 793701 ZFINID:ZDB-GENE-130128-1 Length:344 Species:Danio rerio


Alignment Length:279 Identity:71/279 - (25%)
Similarity:130/279 - (46%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYFWGEKNN-------GYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKL------AHK 58
            ||||.:|.:       |::||......|....||::||:||:..|||:.:|.:|||      |.:
Zfish    70 DYFWTDKRDLQGATVTGFEVLLQKQLKGKQMQKEMAEFIRERIKIEEEYAKNLSKLSMFPMAAQE 134

  Fly    59 AGTLNSTFAPVWTILRTSAEKLSTLHLQMVQKL-TELVKDVAKYADELHKKHKSVKEEESQTLEC 122
            .|||..    .|..|:.|....:.:||:...|| :|:.|.:..:..:..|  |.:|:.:....:.
Zfish   135 EGTLGE----AWAQLKKSLADEAEVHLKFSSKLQSEVEKPLLTFRGDNFK--KDMKKYDHHIADL 193

  Fly   123 VQAIQTSTVAVQKLRDLYASKVQELE------KLRKDNGSHKDAEKLESKLKKLQEEYKALLDKH 181
            .:.:.:...||:|.|...|.:.::||      :::..|.|.:|.:|...|..:..::....:|.:
Zfish   194 RKQLVSRYAAVEKARKALADRQKDLEVKTQQLEIKLSNKSEEDIKKARRKSTQAGDDLMRCVDLY 258

  Fly   182 NPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQ---VHSDFKRQFVDMS 243
            |..::::...|..|....:::|...:..:::.|..| ..|::..||..|   ...|...|.||.:
Zfish   259 NQAQSKWFEEMVTTSMELEKLEVERIEMIQQHLRQY-TTLRHETDMFNQSTLEPVDQLLQSVDPA 322

  Fly   244 VDKLLEQFVLNKYTGLEKP 262
            .|:  |.:|....||..:|
Zfish   323 KDR--ELWVKEHKTGDRRP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 67/275 (24%)
Apolipoprotein 52..214 CDD:279749 36/174 (21%)
AP_Syp1_like_MHD 928..1194 CDD:271171
gas7aNP_001265748.1 WW_FCH_linker <21..69 CDD:293229
F-BAR_GAS7 81..314 CDD:153333 56/239 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.