DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and pstpip1b

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001032668.1 Gene:pstpip1b / 641582 ZFINID:ZDB-GENE-051127-25 Length:379 Species:Danio rerio


Alignment Length:358 Identity:63/358 - (17%)
Similarity:140/358 - (39%) Gaps:90/358 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KELSEFLREKSNIEEQNSKMMSKLAHKA------GTLNSTFAPVWTILRTSAEKLSTLHLQMVQK 90
            |::.|.|:.::..||:..:.:..:|.||      |||.::|..    .:...||...||:|:.::
Zfish     3 KDVEELLKMRALAEEKYGRDLVAIARKAEGQTEIGTLKASFDK----FKEEIEKTGNLHIQLSER 63

  Fly    91 LTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQK----LRDLYASKVQELE--- 148
            :.|.|..:     |:.::|:  :|:..:..|.::.:|...:.:.|    .:.||..:.:|.:   
Zfish    64 IKEEVLKI-----EVFREHQ--REQRKKLEEIIEKLQKPKMVLHKKTMESKRLYEQRCKEADESE 121

  Fly   149 -----KLRKDNGSHKDAEKLESKLK-------KLQEEYKALLDKHNPIKNEFERRMTQTCKRFQE 201
                 |...:..:|:.:||:.::.:       ..:::|:..:|:......::|......|:.||:
Zfish   122 QALGKKTNVNTSTHRQSEKVMNRARLCRQAANLAEKQYRWNVDQLGKTCQDWESTYRSACEVFQQ 186

  Fly   202 IEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQ---------FVLNKYT 257
            .|...:..::..|..:..:|..........:.:         |.|:|||         |:..|.|
Zfish   187 QESERINILRCVLWEHCNLLSKQCVQDDDCYEE---------VRKILEQCDIVADNNNFIKMKKT 242

  Fly   258 GLEKPEMPELEYVALSSGS------RLQQPQVSA-----------SASNSNSATSIQAALRAG-- 303
            ....|  ..:|:...|...      |::..::|.           .|||::.|.......|.|  
Zfish   243 SSHPP--APIEFQCYSDADTNGGVRRIETNRLSVVLSGMSFSGFPEASNNSGAKYTPDQQRIGVT 305

  Fly   304 ---------------NAATTASGSAVSMDQRGD 321
                           :..:.:.|..|::.::|:
Zfish   306 EEKYMVLYEFKAQEDDELSISKGQVVTITEKGE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 50/270 (19%)
Apolipoprotein 52..214 CDD:279749 34/186 (18%)
AP_Syp1_like_MHD 928..1194 CDD:271171
pstpip1bNP_001032668.1 BAR 1..225 CDD:299863 43/241 (18%)
SH3_PSTPIP1 308..360 CDD:212758 3/31 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.