DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and pstpip1a

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001038681.1 Gene:pstpip1a / 571331 ZFINID:ZDB-GENE-050419-251 Length:418 Species:Danio rerio


Alignment Length:354 Identity:82/354 - (23%)
Similarity:153/354 - (43%) Gaps:67/354 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VDFNDYFWGEK---NNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKA----- 59
            :.|.|||||.|   |:||::|...:..|..|.|::.|.|:.::..||:..|.:..:|.|.     
Zfish     4 LQFKDYFWGPKFTSNSGYEILIQRLCDGRRACKDMEELLKMRAMAEERYGKELITIARKTGGQTE 68

  Fly    60 -GTLNSTFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECV 123
             |||.::|..    |:...|.:..||:|    |:.::::.||..:...::.|..:::....:|.|
Zfish    69 IGTLKASFDQ----LKAQMENIGNLHIQ----LSGMLREEAKRMEHFRERQKEQRKKFEGVMEKV 125

  Fly   124 QAIQTSTV-AVQKLRDLYASKVQE-------LEKLRKDNG-SHKDAEKLESKLKK-------LQE 172
            |.|:.|.. ...:.:..|..:.:|       .|||...:. :.|.:||.::|.|:       .::
Zfish   126 QKIKVSLYKKTMESKRTYEQRCREADEAELTAEKLNSTSTVTPKQSEKTQNKAKQCRDAATDAEK 190

  Fly   173 EYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSD--- 234
            :|.:.:::.:.|:.|:|.....||:.||:.|:..:..::..:..:.     ||..:..|..|   
Zfish   191 QYISNIEQLDKIRQEWETTHELTCEVFQQQEDDRINILRNAIWVHC-----NHFSMQCVKEDECY 250

  Fly   235 ----FKRQFVDMSVDKLLEQFVLNKYTGLEKPEMP-------ELEYVALSSG------------S 276
                ...:..|::.|  :..|:..|..| ..|.:|       |.|..|.|:|            |
Zfish   251 EEVRTTLEMCDITED--INSFIKTKSIG-NTPSVPIVFENYYEKEQQADSNGIIRFGGGVMKRFS 312

  Fly   277 RLQQPQVSASASNSNSATSIQAALRAGNA 305
            .|.|...:..:.|:|......|...|.|:
Zfish   313 NLLQGNCAIGSRNNNECIVPSAPPSADNS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 65/296 (22%)
Apolipoprotein 52..214 CDD:279749 39/183 (21%)
AP_Syp1_like_MHD 928..1194 CDD:271171
pstpip1aNP_001038681.1 F-BAR_PSTPIP1 15..258 CDD:153355 55/255 (22%)
SH3_PSTPIP1 365..417 CDD:212758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2080
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.