DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and Pstpip1

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001100294.2 Gene:Pstpip1 / 300732 RGDID:1307557 Length:416 Species:Rattus norvegicus


Alignment Length:398 Identity:88/398 - (22%)
Similarity:160/398 - (40%) Gaps:81/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VDFNDYFWGE---KNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG---T 61
            :.|.|.||..   .:.||:||...:..|....|::.|.||:::..||:..|.:.::|.|||   .
  Rat     5 LQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQIARKAGGQTE 69

  Fly    62 LNSTFAPVWTILRTS-------AEKLSTLHLQMVQKLTELVKDVAKYAD---ELHKKHKSVKE-- 114
            :||        ||||       .|.:.:.|:|:...|.|.::.:.::.:   |..||:::|.:  
  Rat    70 MNS--------LRTSFDSLKQQTENVGSAHIQLALALREELRSLEEFRERQKEQRKKYEAVMDRV 126

  Fly   115 EESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEE------ 173
            ::|:.....:.:::.....||.||  |...::..:....:|..|..||.::|.|:.:|.      
  Rat   127 QKSKLSLYKKTMESKKSYDQKCRD--ADDAEQAFERVSASGHQKQIEKSQTKAKQCKESATEADR 189

  Fly   174 -YKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR 237
             |:..:::....:.|:|:....||:.||..|...|..::..|..:...|........:::.:.:.
  Rat   190 VYRQNIEQLEKARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSMQCVKDDELYEEVRL 254

  Fly   238 QFVDMSVDKLLEQFVLNKYTGLEKP-----------EMPEL--------------EYVALSSGSR 277
            ......|:..:..|:.:|.||.|.|           |:..|              .:..|..||.
  Rat   255 TLEGCDVEGDINGFIQSKSTGREPPAPVPYQNYYDREVTPLTGSPIVQTSCGVIKRFSGLLHGSP 319

  Fly   278 LQQPQVSASASNSNSA----------TSIQAALRAGNAATTASG-------SAVSMDQ----RGD 321
            ...|..:.:||....|          .||:.....||..:.|..       :|.:.|:    .||
  Rat   320 KTTPSQAPAASTETLAPTSEQKELVYASIEVQATQGNLNSAAQDYRALYDYTAQNSDELDISAGD 384

  Fly   322 ALAAISLG 329
            .||.|..|
  Rat   385 ILAVILEG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 64/307 (21%)
Apolipoprotein 52..214 CDD:279749 41/183 (22%)
AP_Syp1_like_MHD 928..1194 CDD:271171
Pstpip1NP_001100294.2 BAR 16..257 CDD:299863 55/250 (22%)
SH3_PSTPIP1 363..415 CDD:212758 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.