DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and sfp47

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_593857.1 Gene:sfp47 / 2542091 PomBaseID:SPAC7D4.02c Length:415 Species:Schizosaccharomyces pombe


Alignment Length:404 Identity:77/404 - (19%)
Similarity:138/404 - (34%) Gaps:148/404 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 QTSTVAVQKLRDLYASKVQ-ELEKLRKDNGSHKDAEKLESKLKKLQEEYKALLDKHNPIKNEFER 190
            :.||.|:...:.|...::. |||              ..:||.||.:..||:  |.....|:..:
pombe    12 EISTEALNNWQQLVEQRISLELE--------------YAAKLAKLTKSIKAI--KQCAPLNDLTK 60

  Fly   191 RMTQTCKRFQEIEEVHLR-------QMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDK-- 246
               |.|....:..:.||.       .:|||:..|:               |.:.:|.:.::.|  
pombe    61 ---QVCVELMQCNKKHLEASRYFQTHVKEFMKEYV---------------DRENKFSNETISKSS 107

  Fly   247 ------LLEQFVL-------NKYTGLEKPEMPELEYVALSSGSRLQQP-QVSASASNSNSATSIQ 297
                  .:|.|:|       ||   |:.|...::|   :::..::.|| :.::..:|..||.|::
pombe   108 AAALMTSMENFILFTNPVYHNK---LQVPSKSDME---IANSLKITQPAEKNSGTANPISAYSLE 166

  Fly   298 AALRAGNAATTASGSAVSMDQRGDALA-AISL-------------------GSGSAASGSIPFAE 342
            .|               .:|:|.:.|: |:|:                   |.....:..:..:.
pombe   167 HA---------------ELDERNNQLSEALSMLRLSPFVNNYYPSYQNRKDGKSLMENRGVVLSV 216

  Fly   343 DPILGAMGSPRPTSPDMLAGANASGIQSQPTGGATSTVKSLRSWFLPTAKQQPSAGAGNFGMAGS 407
            |.:.    ||...||..|.          ||   ||.:.|....|: .||:..|.....:..   
pombe   217 DTVT----SPISQSPKKLT----------PT---TSPINSTSLSFV-DAKKPGSKWPSQYDF--- 260

  Fly   408 GSTNNTTTTTTASNNSNNLNTNNTTATTTTTTGTNNLTTNITKNS-----------PNSEDTSNQ 461
              ...|.:|........:||.||              ...:||:.           |:::.|::.
pombe   261 --PKKTKSTEIPFKTLPSLNINN--------------ERELTKHKLPIVKPKLAVFPSNQATAST 309

  Fly   462 DQTQQQPAEALTPT 475
            .|....|.:|: ||
pombe   310 LQLAPPPVQAI-PT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 33/164 (20%)
Apolipoprotein 52..214 CDD:279749 21/94 (22%)
AP_Syp1_like_MHD 928..1194 CDD:271171
sfp47NP_593857.1 BAR 12..>193 CDD:299863 46/235 (20%)
SH3 356..411 CDD:214620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47409
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.