DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and pstpip2

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:XP_009303409.1 Gene:pstpip2 / 100537857 ZFINID:ZDB-GENE-091204-90 Length:331 Species:Danio rerio


Alignment Length:301 Identity:64/301 - (21%)
Similarity:130/301 - (43%) Gaps:66/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNDYFWG---EKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKA------G 60
            |.|.||.   ....|||.:..::..|....||:.:|::.::.|||:.:|.:..|:.|.      .
Zfish     6 FKDNFWNTDITSTAGYDTIIQHLNDGKRTCKEIEDFMKARAAIEEKYAKELLGLSKKVCGHSEMN 70

  Fly    61 TLNSTFAPVWTILRTSAEKLSTLHLQMVQ--------------KLTELVKDVAKYADELHKK--- 108
            ||..:.    .:.:...|.:|..||.:.|              |..|..|.|.:..|.|||:   
Zfish    71 TLKRSL----DVFKLQTENMSLSHLHLAQTMREEAKKLEDFREKQKEARKKVEQQMDALHKQKAA 131

  Fly   109 --HKSVKEEESQTLECVQAIQT--------STVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKL 163
              .|:.:.::|...:|....:|        :|.:.::...||| |.|:.::      :.::|:::
Zfish   132 QYKKTAEAKKSYDQKCRDKEETEQNMNRSATTCSAKQQEKLYA-KTQQAKQ------AAEEADRI 189

  Fly   164 ESK----LKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNN 224
            .|:    |.|::||:   |::|           .:.|:.|::.|...:..::..:.|:|..|...
Zfish   190 YSQNVSVLGKMREEW---LNEH-----------VKACEFFEKQEVERINTLRNIVWTHLNHLSQQ 240

  Fly   225 HDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMP 265
            .....:::.:.::.....::.:.:|.||..:.|| :||..|
Zfish   241 CVSSDEIYEEVRKSLEQCNIQEDIEHFVNLRRTG-DKPPAP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 60/295 (20%)
Apolipoprotein 52..214 CDD:279749 38/198 (19%)
AP_Syp1_like_MHD 928..1194 CDD:271171
pstpip2XP_009303409.1 BAR 15..253 CDD:299863 52/262 (20%)
T3SSipB 55..192 CDD:293143 28/147 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.