DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8176 and gas7b

DIOPT Version :9

Sequence 1:NP_001097723.1 Gene:CG8176 / 261329 FlyBaseID:FBgn0037702 Length:1220 Species:Drosophila melanogaster
Sequence 2:XP_002663914.4 Gene:gas7b / 100333627 ZFINID:ZDB-GENE-130614-1 Length:461 Species:Danio rerio


Alignment Length:284 Identity:68/284 - (23%)
Similarity:133/284 - (46%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYFWGEK------NNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKL------AHKA 59
            ||||.::      ::|::||......|....||::||:||:..|||:.:|.:|||      |.:.
Zfish   189 DYFWADRKEVQGNSSGFEVLLQKQLKGKQMQKEMAEFVRERIRIEEEYAKNLSKLSQTPLAAQEE 253

  Fly    60 GTLNSTFAPVWTILRTSAEKLSTLHLQMVQKL-TELVKDVAKYADELHKKHKSVKEEESQTLECV 123
            |||..    .||.|:.|....:.:||:...|| :|:.|.:..:.:..   .|.:|:.:.|..:..
Zfish   254 GTLGE----AWTQLKKSLTDEAEVHLKFSSKLHSEVEKPLLAFRENF---KKDMKKFDHQMSDLR 311

  Fly   124 QAIQTSTVAVQKLRDLYASKVQELE------KLRKDNGSHKDAEKLESKLKKLQEEYKALLDKHN 182
            :.:.:...||:|.|...|.:.::||      :::.::.:.:|.:|...|..:..::....:|.:|
Zfish   312 KQLSSRHAAVEKARRALADRQKDLESKTQQMEIKVNSKTEEDIKKARRKSTQAGDDLMRCVDLYN 376

  Fly   183 PIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKL 247
            ..::::...|..:....:.:|...:..:::.|..| ..|::..||       |.:..:: .||||
Zfish   377 QCQSKWFEEMVTSSLELERLEMERVEMIRQHLCQY-TTLRHETDM-------FNQSTIE-PVDKL 432

  Fly   248 L---------EQFVLNKYTGLEKP 262
            |         |.:|....||..:|
Zfish   433 LRCVDPARDRELWVKEHKTGEVRP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8176NP_001097723.1 F-BAR_FCHO 11..269 CDD:153332 64/280 (23%)
Apolipoprotein 52..214 CDD:279749 34/174 (20%)
AP_Syp1_like_MHD 928..1194 CDD:271171
gas7bXP_002663914.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.