DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPVD1 and Rabex-5

DIOPT Version :9

Sequence 1:NP_056450.2 Gene:GAPVD1 / 26130 HGNCID:23375 Length:1487 Species:Homo sapiens
Sequence 2:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster


Alignment Length:429 Identity:101/429 - (23%)
Similarity:167/429 - (38%) Gaps:115/429 - (26%)


- Green bases have known domain annotations that are detailed below.


Human  1114 SQAAHPQDSAFSYRDAKKKLRLALCSADSVAFPVLTHSTRNGLPDHTDPEDNEIVCFLKVQIAEA 1178
            |.||.|.......:|.|       |              |:|...:..|: ||.:|.:       
  Fly     2 STAARPPSLRLGQQDLK-------C--------------RSGCGFYGTPQ-NEGLCSM------- 37

Human  1179 INLQDKNLMAQLQETMRCVCRFDNRTCRKLLASIAEDYRKRAPYIAYLTRCRQGLQTTQAHLERL 1243
                             |.....|...|||..:..|.....:..:|.|.|    .....|||:..
  Fly    38 -----------------CFREKFNDKQRKLKQTGGETGPGSSSSVATLDR----RSPQHAHLQGK 81

Human  1244 LQRVLR---DKEVAN------RYFTTVCVRLLLESKEKKIR-----------EFIQDFQKLTAAD 1288
            :::.:|   |||..|      :.||.|..:.|....:|..:           :|:...::|...|
  Fly    82 VEQQVRKPSDKEQDNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPD 146

Human  1289 D--------------------------KTAQVEDFLQFLYGAMA----QDVIWQNASEEQLQDAQ 1323
            |                          ...::.|.:|..|..::    .|..::.|:.|....|.
  Fly   147 DGKRKLKLEIQRLDSDIRKYMNGNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAI 211

Human  1324 LAIERSVMNRIFKLAFYP----NQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEV--YLREAP 1382
            ...|:.||.:..|..|.|    ::|.|:    .:.:.|::|| .:||.|....|.||  ..|:..
  Fly   212 DFFEKVVMTQNHKFLFSPYFTTDEDSDV----KVQKRIRQLS-WITAKHLDCSIDEVNSEARDLV 271

Human  1383 WPSAQSEIRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCL 1447
            : :|.||:..|.:|.:|::|:||..|.|..|..||..|. .....||||:|.|:||::||||..|
  Fly   272 Y-NAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRAT-GGPASADDFLPALIFVVLKANPVRL 334

Human  1448 LSTVQYISSF--YASCLSGEESYWWMQFTAAVEFIKTID 1484
            .|.:.:::.|  .:..:|||..|::....:|:.||:.::
  Fly   335 HSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENLN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPVD1NP_056450.2 RasGAP_RAP6 84..449 CDD:213331
DUF5601 1272..1335 CDD:407982 15/103 (15%)
VPS9 1383..1484 CDD:366977 37/102 (36%)
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 9/68 (13%)
VPS9 274..373 CDD:280383 37/99 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.